Recombinant Full Length Human SERPINE2 Protein, C-Flag-tagged

• Cat.No.: SERPINE2-1219HFL
• Product Overview: Recombinant Full Length Human SERPINE2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Species: Human
• Source: Mammalian Cells
• Tag: Flag
• Description: This gene encodes a member of the serpin family of proteins, a group of proteins that inhibit serine proteases. Thrombin, urokinase, plasmin and trypsin are among the proteases that this family member can inhibit. This gene is a susceptibility gene for chronic obstructive pulmonary disease and for emphysema. Alternative splicing results in multiple transcript variants.
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Molecular Mass: 41.8 kDa
• AA Sequence: MNWHLPLFLLASVTLPSICSHFNPLSLEELGSNTGIQVFNQIVKSRPHDNIVISPHGIASVLGMLQLGAD GRTKKQLAMVMRYGVNGVGKILKKINKAIVSKKNKDIVTVANAVFVKNASEIEVPFVTRNKDVFQCEVRN VNFEDPASACDSINAWVKNETRDMIDNLLSPDLIDGVLTRLVLVNAVYFKGLWKSRFQPENTKKRTFVAA DGKSYQVPMLAQLSVFRCGSTSAPNDLWYNFIELPYHGESISMLIALPTESSTPLSAIIPHISTKTIDSW MSIMVPKRVQVILPKFTAVAQTDLKEPLKVLGITDMFDSSKANFAKITTGSENLHVSHILQKAKIEVSED
  GTKASAATTAILIARSSPPWFIVDRPFLFFIRHNPTGAVLFMGQINKPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Protein Families: Druggable Genome, Secreted Protein
• Full Length: Full L.

Gene Information

• Gene Name: SERPINE2 serpin family E member 2 [ Homo sapiens (human) ]
• Official Symbol: SERPINE2
• Synonyms: GDN; PI7; PN1; PNI; PI-7; PN-1; GDNPF
• Gene ID: 5270
• mRNA Refseq: NM_006216.4
• Protein Refseq: NP_006207.1
• MIM: 177010
• UniProt ID: P07093