Recombinant Full Length Xylella Fastidiosa Membrane Protein Insertase Yidc(Yidc) Protein, His-Tagged
Cat.No. : | RFL9506XF |
Product Overview : | Recombinant Full Length Xylella fastidiosa Membrane protein insertase YidC(yidC) Protein (Q879S3) (1-565aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Xylella fastidiosa |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-565) |
Form : | Lyophilized powder |
AA Sequence : | MNQTRVLLIFSWLTVATLLWMDWSKNKNETLEISASHNLGVDSNLELEHAVPQIHAGAVP LQKDSQLIAAAPKVPVINVTTDVLQLKLDGFSILAADLLRFPQSKDRGAKPIKLLTDDPN YPYSATTGWVSQSNSPVPNLSTFLPEQPDVSYKLANDQNRLVVPFIWTAANGVSIRRTFT FERGRYAILIRDEIRNSGETPWNAYVFRKLSRVPIPNILNRAMTNPDSFSFNGAVWYSEK GGYERRAFKDYMNDGGLNREIGGGWIALLQHHFFTAWIPQKDQASLYLLAQNGSRDIAEL RGPAFTVAPGQTTTTEARLWVGPKLVEQITKEHVKGLDRVVDYSRFQLMALIGQGLFWIL SHLNSLLHNWGWAIVGLVVLLRIAMYPLSASQYKSAAKMRKFQPRLQQLKERYGEDRQKF QQAMMELYKKEKINPMGGCFPILIQMPIFFALYWVLVESVELRQAPWLGWIQDLTTRDPY FILPLLNIVIMWATQKLTPTPAGMDPIAGKMMQVMPLIFGVMMAFVPSGLALYWVINGGL NLLIQWWMIRQHADFSRKRSRENIK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | yidC |
Synonyms | yidC; PD_2121; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC |
UniProt ID | Q879S3 |
◆ Recombinant Proteins | ||
POLL-1528H | Recombinant Human POLL protein | +Inquiry |
PVR-3157H | Recombinant Human PVR Protein, MYC/DDK-tagged | +Inquiry |
PCMTD2-3147R | Recombinant Rhesus Macaque PCMTD2 Protein, His (Fc)-Avi-tagged | +Inquiry |
SNX1-696C | Recombinant Cynomolgus Monkey SNX1 Protein, His (Fc)-Avi-tagged | +Inquiry |
YUGG-2006B | Recombinant Bacillus subtilis YUGG protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
ApoC-III-3559H | Native Human ApoC-III | +Inquiry |
APOC3-27333TH | Native Human APOC3 | +Inquiry |
F10-5395R | Active Native Rat Coagulation Factor X | +Inquiry |
Lectin-1864W | Active Native Succinylated Wheat Germ Agglutinin Protein, Agarose bound | +Inquiry |
LTF-3211B | Native Bovine Lactoferrin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
Bladder-30R | Rhesus monkey Bladder Lysate | +Inquiry |
ZNF671-2072HCL | Recombinant Human ZNF671 cell lysate | +Inquiry |
DYNLT1-6754HCL | Recombinant Human DYNLT1 293 Cell Lysate | +Inquiry |
MT2A-4096HCL | Recombinant Human MT2A 293 Cell Lysate | +Inquiry |
ASMT-41HCL | Recombinant Human ASMT lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All yidC Products
Required fields are marked with *
My Review for All yidC Products
Required fields are marked with *
0
Inquiry Basket