Recombinant Full Length Methylobacterium Chloromethanicum Membrane Protein Insertase Yidc(Yidc) Protein, His-Tagged
Cat.No. : | RFL28610MF |
Product Overview : | Recombinant Full Length Methylobacterium chloromethanicum Membrane protein insertase YidC(yidC) Protein (B7L2I5) (1-616aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Methylobacterium extorquens |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-616) |
Form : | Lyophilized powder |
AA Sequence : | MGNDKTNMFVAIALSLVVLLGWHYFVTGPASERQRQAAQSQAAQTGAPQTADGIPSPSPR EGSPNAPAPGTLPGAAAQGPVSREDALARSARVRIDTPALYGSIGLKGARIDDVSLKNYH ETVSDESPRIVLLSPTGSANPYYAEFGWVGANAGPLPNADTLWKADGDLLAPGRPLTLTW DNGQGLVFKRIVAVDDKFMFTVRDEVENTSANPVTLYPYSLVSRWGKPQTQGYYVLHEGL IGVLGGDGLQEYTYDKVGKEPAYGGAATQGKAWTNVTGGWVGITDKYWAAAAIPEQDKPF TGAFTERTDGATKIYQTSVRGDAVTLAPNASSVTTQRLFAGAKEVNRINAYEREFGIKQF DLMIDWGWFWFLTKPMFRALDFFFHLLGNFGVSILLVTLILKLFFLPIANRSYVSMAKMK AVQPEMTSIRERYKDDRVKQQQAMMELYKKEKINPVAGCWPVLIQIPVFFALYKVLFITI EMRHAPFFGWIQDLAAPDPTSIVNLFGLLPFTPPEYIPIHLGVWPIIMGITMFIQMKMNP APPDPVQAQVFAFMPIVFTFMLGSFPAGLVIYWAWNNTLSVIQQYVIMRRNGVKVELWDN LRGMFKRGNKSAAAKG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | yidC |
Synonyms | yidC; Mchl_2630; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC |
UniProt ID | B7L2I5 |
◆ Recombinant Proteins | ||
CXCL12-01H | Recombinant Human CXCL12 Protein | +Inquiry |
ZNHIT6-838H | Recombinant Human ZNHIT6 Protein, His-tagged | +Inquiry |
RFL21804AF | Recombinant Full Length Aspergillus Terreus Nadh-Cytochrome B5 Reductase 2(Mcr1) Protein, His-Tagged | +Inquiry |
MROH1-4264H | Recombinant Human MROH1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
MPXV-0334 | Recombinant Monkeypox Virus C3L Protein, C3L (ElF-alpha inhibitor) | +Inquiry |
◆ Native Proteins | ||
C7-102H | Active Native Human C7 Protein | +Inquiry |
CK-5379P | Native Porcine Creatine-Phospho-Kinase | +Inquiry |
Hb-117M | Native Mouse Hb | +Inquiry |
TF-5341H | Native Human Transferring | +Inquiry |
ACE-3047R | Native rabbit ACE | +Inquiry |
◆ Cell & Tissue Lysates | ||
FAM92B-6339HCL | Recombinant Human FAM92B 293 Cell Lysate | +Inquiry |
CASZ1-7823HCL | Recombinant Human CASZ1 293 Cell Lysate | +Inquiry |
RABEPK-525HCL | Recombinant Human RABEPK lysate | +Inquiry |
IRF1-5168HCL | Recombinant Human IRF1 293 Cell Lysate | +Inquiry |
NABP1-451HCL | Recombinant Human NABP1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All yidC Products
Required fields are marked with *
My Review for All yidC Products
Required fields are marked with *
0
Inquiry Basket