Recombinant Full Length Xenopus Tropicalis Transmembrane Protein 56(Tmem56) Protein, His-Tagged
Cat.No. : | RFL12892XF |
Product Overview : | Recombinant Full Length Xenopus tropicalis Transmembrane protein 56(tmem56) Protein (Q6P4N1) (1-259aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-259) |
Form : | Lyophilized powder |
AA Sequence : | MDDSVFISYCVVTGSFLGFQLLFSIISPRTFTKYSSTYRQLSFGKQCEWDSRCVSTTHAL VVGSGCLYILAYDEAVNADPIWGDPFWVKMNVAITCGYLVHDLLLLARFWKVMRDPYMVC HHLAVFYSYGYVLNRGVLPYFANFRLISELSTPFVNQRWFFDVIGKPRSSWPVLLNGLAM ALVFFIVRIAVIPSYYSQVFATFGTEGYIRLGIGPQVAWIVSCVVLDILNVFWMYKIARG FYKVVKAKPDGKPRRNHAD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | tmem56 |
Synonyms | tlcd4; tmem56; TLC domain-containing protein 4; Transmembrane protein 56 |
UniProt ID | Q6P4N1 |
◆ Native Proteins | ||
CP-8074M | Native Mouse Serum Ceruloplasmin | +Inquiry |
Collagen Type I & III-04B | Native Bovine Collagen Type I and III Protein | +Inquiry |
LDH1-18H | Native Human Lactate Dehydrogenase 1 | +Inquiry |
FGG -60R | Native Rabbit Fibrinogen | +Inquiry |
Lectin-1818P | Active Native Peanut Lectin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ATPBD4-8570HCL | Recombinant Human ATPBD4 293 Cell Lysate | +Inquiry |
CD83-2095HCL | Recombinant Human CD83 cell lysate | +Inquiry |
KRTAP10-8-4859HCL | Recombinant Human KRTAP10 293 Cell Lysate | +Inquiry |
Brain-43R | Rabbit Brain Lysate | +Inquiry |
AQP7-104HCL | Recombinant Human AQP7 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All tmem56 Products
Required fields are marked with *
My Review for All tmem56 Products
Required fields are marked with *
0
Inquiry Basket