Recombinant Full Length Xenopus Tropicalis Transmembrane Protein 18(Tmem18) Protein, His-Tagged
Cat.No. : | RFL21333XF |
Product Overview : | Recombinant Full Length Xenopus tropicalis Transmembrane protein 18(tmem18) Protein (Q28GF5) (1-136aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-136) |
Form : | Lyophilized powder |
AA Sequence : | MAEDPGLWTLLERAPIDWKEPWLIGLAVFHILCLIVTYVSFKSYPLQICHFLLMVVLVSC AEYINEFAAMHWRSYSKQQYFDSSGMFISLAFSAPLLCNTIIIVVHWVYKTLCVMTELKT LQQKRKESREKRKKKE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | tmem18 |
Synonyms | tmem18; TEgg098f11.1; Transmembrane protein 18 |
UniProt ID | Q28GF5 |
◆ Recombinant Proteins | ||
CDA-796H | Recombinant Human Cytidine Deaminase, His-tagged | +Inquiry |
RAX-13974M | Recombinant Mouse RAX Protein | +Inquiry |
POLB-13067M | Recombinant Mouse POLB Protein | +Inquiry |
RFL10475MF | Recombinant Full Length Methanocaldococcus Jannaschii Upf0333 Protein Mj0431(Mj0431) Protein, His-Tagged | +Inquiry |
TNFRSF1A-456H | Recombinant Human TNFRSF1A Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
MB-8227H | Native Human Heart Myoglobin | +Inquiry |
CSN-36H | Native Human COP9 signalosome Protein | +Inquiry |
MMP11-27648TH | Native Human MMP11 | +Inquiry |
COL1A1-26195TH | Native Human COL1A1 | +Inquiry |
RO60-16C | Native Cattle RO60 Protein, Biotinlyated | +Inquiry |
◆ Cell & Tissue Lysates | ||
CDH5-1201RCL | Recombinant Rat CDH5 cell lysate | +Inquiry |
TCP11L2-1165HCL | Recombinant Human TCP11L2 293 Cell Lysate | +Inquiry |
Hypothalamus-557M | MiniPig Hypothalamus Lysate, Total Protein | +Inquiry |
NARS2-3967HCL | Recombinant Human NARS2 293 Cell Lysate | +Inquiry |
TP53RK-856HCL | Recombinant Human TP53RK 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All tmem18 Products
Required fields are marked with *
My Review for All tmem18 Products
Required fields are marked with *
0
Inquiry Basket