Recombinant Full Length Xenopus Tropicalis Selenoprotein N(Sepn1) Protein, His-Tagged
Cat.No. : | RFL24579XF |
Product Overview : | Recombinant Full Length Xenopus tropicalis Selenoprotein N(sepn1) Protein (Q01H84) (1-562aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-562) |
Form : | Lyophilized powder |
AA Sequence : | MSADLRKRKKDTTADNDAPQEAQAEEENKKEKPSSCRYRFLWKLLLGLLLIALLFGIKIH RDNELVRQQEAALRTLGAEGLFLFSSLDTDNDMHISPEEFKPISEKLTGISTTSDYEEEE LLDPNGETLSVASRFQPLLMETMTKSKDGFLGITHSALSGLRNWTTPVVPNNVFYAGQFK AFLPPKNKLEVGNPWWIIPSELSIFTGYLPNNRIYPPPPKGKEVIIHKLLSMFHPRPFIK TRFAPQGSVACIRAISDFYYDIVFRIHAEFQLNEPPNFPFWFSPGQFTGNIVISKDAAHV RHFKLFVPNNRTLNVDMEWLYGASESSNMEVDIGYLPQMEIESLGPSIPSTIYDENGNIM ESRNAEGEAIEFVFEDINWQSEMTFEEAARKLEVTMYPFKRVSYYPFPEAFDRALAEKKL VHSVLLWGALDDQSCUGSGRTLRETVLESLPVLALLNESFISTWSLVKELEELQSNKDSY ATFASLHLEKYNFPVEMMICLPNGTVVHHINANYFLDITSLKPDEVETNLFSFSDGVEDL STVTYIKFLKEGLEKAKPFLHS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | selenon |
Synonyms | selenon; sepn1; TEgg073a06.1; Selenoprotein N; SelN |
UniProt ID | Q01H84 |
◆ Recombinant Proteins | ||
GAST-5828D | Recombinant Dog GAST protein, His & GST-tagged | +Inquiry |
XRCC6-1548H | Recombinant Human XRCC6 protein | +Inquiry |
ERBB4-3451H | Recombinant Human ERBB4 Protein, GST-tagged | +Inquiry |
CCL5-0642H | Recombinant Human CCL5 Protein, GST-Tagged | +Inquiry |
PLA2G4A-4321HFL | Recombinant Full Length Human PLA2G4A protein, Flag-tagged | +Inquiry |
◆ Native Proteins | ||
MMP2-47H | Native Human MMP-2/TIMP-2 Complex | +Inquiry |
ALB-5363B | Native Bovine Albumin | +Inquiry |
IgA2-211H | Native Human Immunoglobulin A2 (IgA2) | +Inquiry |
MBP-89S | Native Swine MBP Protein | +Inquiry |
GUSB-12H | Active Native Helix pomatia b-Glucuronidase | +Inquiry |
◆ Cell & Tissue Lysates | ||
CARTPT-001HCL | Recombinant Human CARTPT cell lysate | +Inquiry |
Testis-837M | Mini pig Testis Membrane Lysate, Total Protein | +Inquiry |
DLX1-6908HCL | Recombinant Human DLX1 293 Cell Lysate | +Inquiry |
SNAPIN-1635HCL | Recombinant Human SNAPIN 293 Cell Lysate | +Inquiry |
HNRNPA1L2-5451HCL | Recombinant Human HNRNPA1L2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All selenon Products
Required fields are marked with *
My Review for All selenon Products
Required fields are marked with *
0
Inquiry Basket