Recombinant Full Length Xenopus Tropicalis Protein Odr-4 Homolog(Odr4) Protein, His-Tagged
Cat.No. : | RFL23776XF |
Product Overview : | Recombinant Full Length Xenopus tropicalis Protein odr-4 homolog(odr4) Protein (Q0VA36) (1-448aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-448) |
Form : | Lyophilized powder |
AA Sequence : | MGRSYYVDDGVEKYFSKLIQQQKAYVTGLLIGQYSSQRDYAVLAAQTPQKEDQSEETKSG FSKLEGIDDEWVSMHASQLGRMLPGGLMVLGVFLMTSPDLSKDAQNVLRKLVFTVEKSSM KNRLWNFDDDDVSERVTLHICSATKKITCRTYDINDPKSTPKPADWKYQSSGLSWLTIDC SVRVDVTIPLTSSSLTYQERQKSIRLGLVKWAKEIEDSLVLFNGQVKDKSADLFEEQKKS SRSSSHYSPQIITANVLTAAPLIDSTRSTALVQPCKSSLTIQGVVKCCGYIHSNRPKVKD ALQAVKRDILNTIQARCEMLFEDMMLNGPSKGTENEVCPLPQRVFVPIKGSSLKLCDYLF GDETSSDLQSHFLEIMDQEVEQNELEFPEKKCSCTQPEERESEPVSYNLESKPVDQANSS SKFLLNKGLLISTVVASIAVIISFYYII |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | odr4 |
Synonyms | odr4; Protein odr-4 homolog |
UniProt ID | Q0VA36 |
◆ Recombinant Proteins | ||
Pla2r1-10608M | Recombinant Mouse Pla2r1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Vps39-6941M | Recombinant Mouse Vps39 Protein, Myc/DDK-tagged | +Inquiry |
RORC-17H | Recombinant Human RORC protein, GST-tagged | +Inquiry |
RFL22807HF | Recombinant Full Length Human Glipr1-Like Protein 2(Glipr1L2) Protein, His-Tagged | +Inquiry |
CD93-4127H | Recombinant Human CD93 Protein (Met1-Lys580), C-His tagged | +Inquiry |
◆ Native Proteins | ||
LTF-312H | Native Human LTF protein | +Inquiry |
CGB-8048H | Native Human Urine Beta Chorionic Gonadotropin (b-hCG) | +Inquiry |
TG-22P | Native Porcine Thyroglobulin (TG) Protein | +Inquiry |
IgE-01M | Native Mouse IgE protein | +Inquiry |
APOH-4217H | Native Human APOH protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
QDPR-520HCL | Recombinant Human QDPR lysate | +Inquiry |
Jejunum-526D | Dog Jejunum Lysate, Total Protein | +Inquiry |
LDHAL6A-978HCL | Recombinant Human LDHAL6A cell lysate | +Inquiry |
CETP-7559HCL | Recombinant Human CETP 293 Cell Lysate | +Inquiry |
TMEM147-999HCL | Recombinant Human TMEM147 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All odr4 Products
Required fields are marked with *
My Review for All odr4 Products
Required fields are marked with *
0
Inquiry Basket