Recombinant Full Length Xenopus Tropicalis Marvel Domain-Containing Protein 2(Marveld2) Protein, His-Tagged
Cat.No. : | RFL5805XF |
Product Overview : | Recombinant Full Length Xenopus tropicalis MARVEL domain-containing protein 2(marveld2) Protein (Q0IHQ3) (1-568aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-568) |
Form : | Lyophilized powder |
AA Sequence : | MSGGGSSSGPRSKDRNLNGRSAQYDEVPADPRHPETNLETLHDRDLALSADPLPPPPLPL HPPFGAEFYPSDSEEPVTTLELRPVRRFIPDSWKNIFKGKKENPWENPMTEINYTSGGVP CSPPRSPSLPASEPHGKNLAGDSKTVASSYRDPYGGSGGSYNSRREEEAMLPHDPYGSLG RQTQTVKTYSERVEEYNMRYAYMKSWAGLLRILCIVELLLGAAVFACVTAYIHKDNEWYN MFGYSQPYGYTASMQGGYYYSGPKTPFVLVVAGLAWIVTIILLVLGMSMYYRTILLDSTW WPLTEFGINISLFILYMAGAIVYVNDTNRGGLCYYQLFNTPVNASFCRVEGGQTAAIIFL FVSMLMYFISAMVSLKLWRHESARKRREFLGQEMNPNQISPPKVMREVALGNGHMIDVPD QQRDMRKVEMKPELLSGYIPAGHIPKPIVMPDYVAKYQAIKAEDERERYKAVFNDQFAEY KELHAEVQAVMKKFSELDAVMQKLPRNPENQHEYERIAKVLQEYQKKKNEPTFLEKKERC EYLKNKLSHIKQRIQEYDKVMDWNDGYN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | marveld2 |
Synonyms | marveld2; mrvldc2; TGas093b21.1; MARVEL domain-containing protein 2 |
UniProt ID | Q0IHQ3 |
◆ Native Proteins | ||
PMSG-01M | Native Pregnant Mare Serum Gonadotropin, Tag Free | +Inquiry |
IgA2-211H | Native Human Immunoglobulin A2 (IgA2) | +Inquiry |
VTN -61R | Native Rabbit multimeric vitronectin | +Inquiry |
Collagen Type I-09B | Native Bovine Collagen Type I Protein | +Inquiry |
IgG-206M | Native Monkey Immunoglobulin G | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLIT2-1683HCL | Recombinant Human SLIT2 293 Cell Lysate | +Inquiry |
PCSK1-2249HCL | Recombinant Human PCSK1 cell lysate | +Inquiry |
SLFN5-611HCL | Recombinant Human SLFN5 lysate | +Inquiry |
PLCD4-3128HCL | Recombinant Human PLCD4 293 Cell Lysate | +Inquiry |
Lymph node-330H | Human Lymph node Liver Cirrhosis Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All marveld2 Products
Required fields are marked with *
My Review for All marveld2 Products
Required fields are marked with *
0
Inquiry Basket