Recombinant Full Length Xenopus Tropicalis Germ Cell-Specific Gene 1-Like Protein(Gsg1L) Protein, His-Tagged
Cat.No. : | RFL23899XF |
Product Overview : | Recombinant Full Length Xenopus tropicalis Germ cell-specific gene 1-like protein(gsg1l) Protein (A4IIV4) (1-322aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-322) |
Form : | Lyophilized powder |
AA Sequence : | MELSRRNRSLLSVVLNLLALSFSVAAFFTSYWCEGTHKVVKPPCLSAVKSKNCQALALNS SSTGSDATDTNGTLNPNVVHYNWETGDDKYAFKYFHTGFWFSCEKHQGEEACRSFIELSP DSEKGVLWLSVISEFLYIILLSLGFLLMCLEFFSSSNFIDGLKINAFAAIITVLSGLLGM VAHMMYMTVFQVTVNLGPKDWRPQTWYYGWSFGLAWLSFTLCMSASVLTLNTYTKTILEF KYRRRIFEKNVRECNPFLDPEMVRFLWEKYIFSVSSTVEDPFNWHKGFGSPIFVDIGSIT DLPGAVKEEERGMDLEDDGDQC |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | gsg1l |
Synonyms | gsg1l; Germ cell-specific gene 1-like protein; GSG1-like protein |
UniProt ID | A4IIV4 |
◆ Native Proteins | ||
Ngf-182M | Active Native Mouse Ngf Protein | +Inquiry |
Protein C-89H | Native Human Protein C | +Inquiry |
AMY2-5364P | Native Pig Amylase, Alpha 2B (pancreatic) | +Inquiry |
Fgb-64R | Native Rat Fibrinogen, FITC Labeled | +Inquiry |
IgG-218D | Native Dog Immunoglobulin G | +Inquiry |
◆ Cell & Tissue Lysates | ||
PHC3-1343HCL | Recombinant Human PHC3 cell lysate | +Inquiry |
FCGRT & B2M-1545MCL | Recombinant Mouse FCGRT & B2M cell lysate | +Inquiry |
KBTBD6-889HCL | Recombinant Human KBTBD6 cell lysate | +Inquiry |
SERTAD2-1934HCL | Recombinant Human SERTAD2 293 Cell Lysate | +Inquiry |
AHNAK2-42HCL | Recombinant Human AHNAK2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All gsg1l Products
Required fields are marked with *
My Review for All gsg1l Products
Required fields are marked with *
0
Inquiry Basket