Recombinant Full Length Xenopus Tropicalis Atpase Family Aaa Domain-Containing Protein 3(Atad3) Protein, His-Tagged
Cat.No. : | RFL9286XF |
Product Overview : | Recombinant Full Length Xenopus tropicalis ATPase family AAA domain-containing protein 3(atad3) Protein (Q6NVR9) (1-594aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-594) |
Form : | Lyophilized powder |
AA Sequence : | MSWLFGLNKGQQGPPSVPGFPEPPSPPGGSGDGGDKNKPKDKWSNFDPTGLERAAKAARE LDQSRHAKEALNLAKVQEETLQLEQQSKIKEYEAAVEQLKNEQIRVQAEERRKTLNEETK QHQARAQYQDKLARQRYEDQLRQQQLQNEENLRRQEESVQKQEAMRKATVEHEMELRHKN EMLRIEAEARARAKVERENADIIRENIRLKAAEHRQTVLESIKTAGTVFGEGFRAFISDW DKVTATVAGLSLLAVGIYTAKNATGVAGRYIEARLGKPSLVRDTSRFTVAEAVKHPVKIS KRLLSKIQDALEGVILSPKLEERVRDIAIATRNTKANKGLYRNILMYGPPGTGKTLFAKK LAMHSGMDYAIMTGGDVAPMGREGVTAMHKVFDWAGTSKRGLLLFVDEADAFLRKRSTEK ISEDLRATLNAFLYRTGEQSNKFMLVLASNQPEQFDWAINDRIDEIVHFDLPGLEERERL VRLYFDKYVLQPASEGKQRLKVAQFDYGKKCSDLAQLTEGMSGREISKLGVAWQAAAYAS EDGILNEAMIDARVADAIRQHQQKMEWLKAEGKENAAKESGKNPLQPLLEGTPV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | atad3 |
Synonyms | atad3; ATPase family AAA domain-containing protein 3 |
UniProt ID | Q6NVR9 |
◆ Recombinant Proteins | ||
RAD51L1-7388M | Recombinant Mouse RAD51L1 Protein, His (Fc)-Avi-tagged | +Inquiry |
IVL-2786R | Recombinant Rat IVL Protein, His (Fc)-Avi-tagged | +Inquiry |
SAP076A-020-2203S | Recombinant Staphylococcus aureus (strain: PM86, other: HA-MRSA) SAP076A_020 protein, His-tagged | +Inquiry |
Mib2-1886R | Recombinant Rat Mib2 protein, His & T7-tagged | +Inquiry |
Bcam-1838M | Recombinant Mouse Bcam Protein, Myc/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
GGT1-5353H | Native Human Gamma-Glutamyltransferase 1 | +Inquiry |
IgG-218D | Native Dog Immunoglobulin G | +Inquiry |
VTN-3H | Native Human multimeric vitronectin, Biotin labeled | +Inquiry |
IgG-347G | Native Guinea Pig Gamma Globulin Fraction | +Inquiry |
Proc-5346M | Native Mouse Protein C | +Inquiry |
◆ Cell & Tissue Lysates | ||
ADH4-29HCL | Recombinant Human ADH4 cell lysate | +Inquiry |
IFI27-5296HCL | Recombinant Human IFI27 293 Cell Lysate | +Inquiry |
USP47-728HCL | Recombinant Human USP47 lysate | +Inquiry |
SELE-2992HCL | Recombinant Human SELE cell lysate | +Inquiry |
TSC22D3-723HCL | Recombinant Human TSC22D3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All atad3 Products
Required fields are marked with *
My Review for All atad3 Products
Required fields are marked with *
0
Inquiry Basket