Recombinant Full Length Xenopus Laevis Zinc Transporter 6-A(Slc30A6-A) Protein, His-Tagged
Cat.No. : | RFL35579XF |
Product Overview : | Recombinant Full Length Xenopus laevis Zinc transporter 6-A(slc30a6-a) Protein (Q6AZN8) (1-464aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Xenopus laevis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-464) |
Form : | Lyophilized powder |
AA Sequence : | MGTIYLFRKTQRSLLGKLAQEFRLVTADRRSWKILLFGAINVVCTAFLLTWCSSTNSMAL TAYTYLTIFDLFSLITSLISYWVTMKKPSPTYSFGFERFEVLAVFASTVLAQLGALFILK ESAERFIEQPEIHTGRLLVGTFVALFFNLFTMLSIRNKPFAYVSDAASTSWLQEHVADLS RSLCGIIPGLSSIFLPRMNPFVLIDIAGALALCITYMLIEINNYFAVDTASAVAIAVMTF GTMYPMSVYSGKVLLQTTPPHVIGQLDKLLREVSTLDGVLEVRNEHFWTLGFGTMAGSVH VRIRRDANEQMVLAHVTNRLSTLVSTLTVQIFKDDWARPVLASGTMPPNMLNIPEHHVIQ MPSLKSTIDELNPLTSTPSKPSSPPPEFAFNTPGKNMNPVILSNNQMRPFGVGYNYGTTP YTTTFNQGLGVPGVGNTQGLRTGLTNVANRYGTYTPGQFTQFRQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | slc30a6-a |
Synonyms | slc30a6-a; znt6-a; Zinc transporter 6-A; ZnT-6-A; Solute carrier family 30 member 6-A |
UniProt ID | Q6AZN8 |
◆ Native Proteins | ||
CAT-1646H | Native Human Catalase Protein | +Inquiry |
CAPN1-186p | Active Native porcine Calpain-1 | +Inquiry |
Tropomyosin-894R | Native Rabbit Tropomyosin Protein | +Inquiry |
Collagen-57H | Native Human Collagen Type II | +Inquiry |
Acylase-3P | Active Native Porcine Acylase | +Inquiry |
◆ Cell & Tissue Lysates | ||
MED7-4379HCL | Recombinant Human MED7 293 Cell Lysate | +Inquiry |
PTPRF-1439HCL | Recombinant Human PTPRF cell lysate | +Inquiry |
DAZAP1-7069HCL | Recombinant Human DAZAP1 293 Cell Lysate | +Inquiry |
Adrenal-633B | Bovine Adrenal Whole Lysate, Total Protein | +Inquiry |
TRIM61-764HCL | Recombinant Human TRIM61 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All slc30a6-a Products
Required fields are marked with *
My Review for All slc30a6-a Products
Required fields are marked with *
0
Inquiry Basket