Recombinant Full Length Xenopus Laevis Transmembrane Protein 120B-A(Tmem120B-A) Protein, His-Tagged
Cat.No. : | RFL4626XF |
Product Overview : | Recombinant Full Length Xenopus laevis Transmembrane protein 120B-A(tmem120b-a) Protein (Q5EAX9) (1-335aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Xenopus laevis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-335) |
Form : | Lyophilized powder |
AA Sequence : | MSLQKCQEEWSEIEKEFQQLQETHKVYKQKLEELNSLQNLCSSCINKHKRRLTEFKGNLH GLKRTSNLEEKELVQQIDGTIKERRNAFFDMEAYLPKKNGLYLNLVLGNVNVTLLSTQAK FAYKDEYEKFKLYLTIILLLGAITCRFVLNYRVTDEVFNFLLVWYYCTLTIRESILISNG SRIKGWWVSHHYVSTFLSGVMLTWPDGLMYQIFRNQFLAFSIFQSCVQFLQYYYQSGCLY RLRALGERNHLDLTVEGFQSWMWRGLTFLLPFLFFGHFWQLYNAITLFGLSRHDACKEWQ VFVLALTFLLLFLGNFLTTLKVVHTKFQKNKLKKP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | tmem120b-a |
Synonyms | tmem120b-a; Transmembrane protein 120B-A |
UniProt ID | Q5EAX9 |
◆ Recombinant Proteins | ||
NDEL1-3927R | Recombinant Rat NDEL1 Protein | +Inquiry |
RUSC1-872H | Recombinant Human RUSC1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Bdnf-703M | Recombinant Mouse Bdnf Protein, MYC/DDK-tagged | +Inquiry |
RFL16500DF | Recombinant Full Length Nostoc Sp. Apocytochrome F(Peta) Protein, His-Tagged | +Inquiry |
C19orf10-10430H | Recombinant Human C19orf10, His-tagged | +Inquiry |
◆ Native Proteins | ||
Actin-21R | Native Rabbit Actin Protein | +Inquiry |
IgA-246H | Native Hamster Immunoglobulin A | +Inquiry |
TPO-702H | Native Human Thyroid Peroxidase | +Inquiry |
Egf-635R | Native Rat Egf | +Inquiry |
VTN-31737TH | Native Human VTN | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC7A6-610HCL | Recombinant Human SLC7A6 lysate | +Inquiry |
TNFSF13B-2025HCL | Recombinant Human TNFSF13B cell lysate | +Inquiry |
Gallbladder-196H | Human Gallbladder Membrane Lysate | +Inquiry |
VPREB3-398HCL | Recombinant Human VPREB3 293 Cell Lysate | +Inquiry |
SNRPA-1619HCL | Recombinant Human SNRPA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All tmem120b-a Products
Required fields are marked with *
My Review for All tmem120b-a Products
Required fields are marked with *
0
Inquiry Basket