Recombinant Full Length Xenopus Laevis Torsin-4A-A(Tor4A-A) Protein, His-Tagged
Cat.No. : | RFL7803XF |
Product Overview : | Recombinant Full Length Xenopus laevis Torsin-4A-A(tor4a-a) Protein (Q0IHC5) (1-420aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Xenopus laevis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-420) |
Form : | Lyophilized powder |
AA Sequence : | MEETESSTQTPVPQHGISLASYPVRAVIRMRRKIRTLKKSRLQLDLTGGRSLDSAKASLR RQISMDRATLFKSSTYEKQQYFNFDTPTLEKLALNSQIRKRNRKKSRHVLYPGNVRKCLP VEHKSKAKRCLLLFIGIVCFQILNAIENLDDNLQKYDLDGLEKTLQREVFGQKRAIEKLM DHLQDYLATHYHNKPLVLSFNGPSGVGKSHTGRLLAKHFRSIMDNDFVLQYYTMHNCPNE NDVTQCQSEMSGLISEMISRAEIEEKIPVFIFDEVEVMPVALLDVLHRYFQLNQSNEYLN AVYILISNIGGNEITKFVLQNASNDFLNLPQELHQIVISSLQKHHSLWDVAEIVPFTLLE KKHILDCFLDELLREGFYPDHSNIESLAGQLRYYTKENKEYSISGCKQVVAKVNLLQPYT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | tor4a-a |
Synonyms | tor4a-a; Torsin-4A-A; Torsin family 4 member A-A |
UniProt ID | Q0IHC5 |
◆ Recombinant Proteins | ||
TNFRSF1B-6477H | Recombinant Human TNFRSF1B Protein (Pro24-Thr206), C-His tagged | +Inquiry |
GHRH-2869H | Recombinant Human GHRH Protein (Cys19-Gly108), N-GST tagged | +Inquiry |
Ppia-5038M | Recombinant Full Length Mouse Ppia Protein, Myc/DDK-tagged | +Inquiry |
RFL34040HF | Recombinant Full Length Sensory Rhodopsin(Sop) Protein, His-Tagged | +Inquiry |
SENP6-14882M | Recombinant Mouse SENP6 Protein | +Inquiry |
◆ Native Proteins | ||
IgG-339H | Native Horse IgG | +Inquiry |
Acid phosphatase-158 | Active Native Wheat Germ Acid phosphatase Protein | +Inquiry |
Factor Xia-65H | Native Human Factor Xia | +Inquiry |
CP-26450TH | Native Human CP | +Inquiry |
Alpha Macroglobulin-86M | Native Mouse Alpha Macroglobulin | +Inquiry |
◆ Cell & Tissue Lysates | ||
ATP4B-8607HCL | Recombinant Human ATP4B 293 Cell Lysate | +Inquiry |
SMCO4-8334HCL | Recombinant Human C11orf75 293 Cell Lysate | +Inquiry |
CDK3-327HCL | Recombinant Human CDK3 cell lysate | +Inquiry |
RBMS1-2463HCL | Recombinant Human RBMS1 293 Cell Lysate | +Inquiry |
FOS-6168HCL | Recombinant Human FOS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All tor4a-a Products
Required fields are marked with *
My Review for All tor4a-a Products
Required fields are marked with *
0
Inquiry Basket