Recombinant Full Length Xenopus Laevis Melanopsin-B(Opn4B) Protein, His-Tagged
Cat.No. : | RFL17429XF |
Product Overview : | Recombinant Full Length Xenopus laevis Melanopsin-B(opn4b) Protein (O57422) (1-534aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Xenopus laevis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-534) |
Form : | Lyophilized powder |
AA Sequence : | MDLGKTVEYGTHRQDAIAQIDVPDQVLYTIGSFILIIGSVGIIGNMLVLYAFYRNKKLRT APNYFIINLAISDFLMSATQAPVCFLSSLHREWILGDIGCNVYAFCGALFGITSMMTLLA ISINRYIVITKPLQSIQWSSKKRTSQIIVLVWMYSLMWSLAPLLGWSSYVPEGLRISCTW DYVTSTMSNRSYTMMLCCCVFFIPLIVISHCYLFMFLAIRSTGRNVQKLGSYGRQSFLSQ SMKNEWKMAKIAFVIIIVFVLSWSPYACVTLIAWAGHGKSLTPYSKTVPAVIAKASAIYN PIIYGIIHPKYRETIHKTVPCLRFLIREPKKDIFESSVRGSIYGRQSASRKKNSFISTVS TAETVSSHIWDNTPNGHWDRKSLSQTMSNLCSPLLQDPNSSHTLEQTLTWPDDPSPKEIL LPSSLKSVTYPIGLESIVKDEHTNNSCVRNHRVDKSGGLDWIINATLPRIVIIPTSESNI SETKEEHDNNSEEKSKRTEEEEDFFNFHVDTSLLNLEGLNSSTDLYEVVERFLS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | opn4b |
Synonyms | opn4b; mop; Melanopsin-B; Opsin-4B; xMOP |
UniProt ID | O57422 |
◆ Native Proteins | ||
PLG -62R | Native Rabbit plasmin | +Inquiry |
TTR-706H | Native Human Transthyretin | +Inquiry |
CGB-1850H | Native Human Chorionic Gonadotropin, Beta Polypeptide | +Inquiry |
Apotransferrin-37D | Native dog Apotransferrin | +Inquiry |
TGase-12S | Active Native Streptoverticillium mobaraense Transglutaminase Protein (Food Grade) | +Inquiry |
◆ Cell & Tissue Lysates | ||
FAM177A1-6402HCL | Recombinant Human FAM177A1 293 Cell Lysate | +Inquiry |
MET-1931CCL | Recombinant Canine MET cell lysate | +Inquiry |
TNFRSF1B-1048CCL | Recombinant Cynomolgus TNFRSF1B cell lysate | +Inquiry |
PIP4K2C-3174HCL | Recombinant Human PIP4K2C 293 Cell Lysate | +Inquiry |
HMP19-5465HCL | Recombinant Human HMP19 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All opn4b Products
Required fields are marked with *
My Review for All opn4b Products
Required fields are marked with *
0
Inquiry Basket