Recombinant Full Length Xenopus Laevis Hyaluronan Synthase-Related Protein(Has-Rs) Protein, His-Tagged
Cat.No. : | RFL19455XF |
Product Overview : | Recombinant Full Length Xenopus laevis Hyaluronan synthase-related protein(has-rs) Protein (O57428) (1-583aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Xenopus laevis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-583) |
Form : | Lyophilized powder |
AA Sequence : | MENTTDPENIPVSKPKYPTIRRILSQTFRILLLFSITTAYVLGYQALCHQGLLITFGLYG AAMLLHLLMQGIFANLEIRRIEKRDGVCSFKKTVALTITGYQENPDYLRQCLESCKGMKY PKDKLKIILVIDGNNEEDVYMMEIFKEVFHGEDVGTYVWQENYHTWNIPSEESEDSSSEI SSFPWKNEGIQMVEELVRTKRCVCIMQQWGGKREVMYTAFRALGTSVDFILVCNSDIKLD KMATVELVKVLEDDDKNGAVGGDVRVWNRHDSFISFMSSLRYWMVFNMEIACQSYFDSVT YIRGSLGMYRNDILQAFLEFWYNKTFLGTRCPIGDDRFLTNRVLSMGYRTKYSHKSCAYA PCQYLRWLNQQTPWARSYFRMWFCNAQWWHQHHIWMTYESATGIFFPFFVTAVLIRLMYS SSLCNIVWLFLCIQIMSLLLSLYASWQSKKLSMVLMSLYSTLYIIWLLPCQLVALLTIAK SDWGTSGRKKVVNNYVPLFSLSIWAAVLLGGLCYSMYIGCRKDWSKPQANRELYHLLYGC AGYMAYWVLMTVIYCVSGSCCKMRSQAVPQTHDITSLSVSLLV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | has-rs |
Synonyms | has-rs; hasrs; Hyaluronan synthase-related protein; Hyaluronan synthase-related sequence; xHAS-rs |
UniProt ID | O57428 |
◆ Recombinant Proteins | ||
Sesn3-2053M | Recombinant Mouse Sesn3 Protein, His-tagged | +Inquiry |
Galns-3140M | Recombinant Mouse Galns Protein, Myc/DDK-tagged | +Inquiry |
TRMT61A-9641M | Recombinant Mouse TRMT61A Protein, His (Fc)-Avi-tagged | +Inquiry |
RNF181-685H | Recombinant Human RNF181 Protein, MYC/DDK-tagged | +Inquiry |
RFL3342SF | Recombinant Full Length Schizosaccharomyces Pombe Meiotically Up-Regulated Gene 89 Protein(Mug89) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
APOA2-8036H | Native Human ApoLipoprotein APOA2 | +Inquiry |
Lectin-1869W | Active Native Wisteria Floribunda Lectin Protein, Biotinylated | +Inquiry |
PKLR-244R | Active Native Rabbit Pyruvate Kinase | +Inquiry |
Proteoglycans-54B | Native Bovine Proteoglycans | +Inquiry |
C1S-550H | Active Native Human C1S Enzyme | +Inquiry |
◆ Cell & Tissue Lysates | ||
RBPMS-2451HCL | Recombinant Human RBPMS 293 Cell Lysate | +Inquiry |
PYCRL-2646HCL | Recombinant Human PYCRL 293 Cell Lysate | +Inquiry |
TRIM16L-793HCL | Recombinant Human TRIM16L 293 Cell Lysate | +Inquiry |
ZNF449-71HCL | Recombinant Human ZNF449 293 Cell Lysate | +Inquiry |
C11orf74-8335HCL | Recombinant Human C11orf74 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All has-rs Products
Required fields are marked with *
My Review for All has-rs Products
Required fields are marked with *
0
Inquiry Basket