Recombinant Full Length Schizosaccharomyces Pombe Meiotically Up-Regulated Gene 89 Protein(Mug89) Protein, His-Tagged
Cat.No. : | RFL3342SF |
Product Overview : | Recombinant Full Length Schizosaccharomyces pombe Meiotically up-regulated gene 89 protein(mug89) Protein (Q1MTQ5) (1-396aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Schizosaccharomyces pombe |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-396) |
Form : | Lyophilized powder |
AA Sequence : | MPEALNENVSDTASNGPVAKTRAPPNTSFRQQRIKSWQPLLTPKIVLPLFFVLGIIFGPL GGGLLYASSIVQELVVDYTDCETLASYDEFSAVPSKKYTASFDQSGTIGFDKESTYWKLE KILDKDLDMDVNYCIIRFTVPSVLKAPIFIYYRLTNFFQNHRRYAKSVDEKQLQGVALTA DEVKGGNCFPLEVNEDDKPYYPCGLIANSLFNDTFSSLRLLDDNSVYTFSTKNIAWASDK RRFLKTNYSPDDVAPPPNWVLRYPDGYTESNMPDLSTMENLQVWMRTAGLPTFSKLAMRN DNDDIFPGTYEIKIGLFFPVKSFDGTKSLVLTTRSVLGGKNPFLGIAYIVVSAVCVVLGT VFTLRHFIRPRKLADHRYLNWDSEENNLAPHLSDRP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | mug89 |
Synonyms | mug89; SPBC1773.11c; Meiotically up-regulated gene 89 protein |
UniProt ID | Q1MTQ5 |
◆ Native Proteins | ||
CYCS-17B | Native Bovine Cytochrome C Protein | +Inquiry |
TF-8273H | Native Human Serum Transferrin HOLO(iron-saturated) | +Inquiry |
IgG2-229H | Native Human Immunoglobulin G2 (IgG2) | +Inquiry |
Ngf-298M | Active Native Mouse Nerve Growth Factor | +Inquiry |
Ferritin-180M | Native Mouse Ferritin | +Inquiry |
◆ Cell & Tissue Lysates | ||
AKAP1-8942HCL | Recombinant Human AKAP1 293 Cell Lysate | +Inquiry |
SIRT7-1828HCL | Recombinant Human SIRT7 293 Cell Lysate | +Inquiry |
AMIGO3-8881HCL | Recombinant Human AMIGO3 293 Cell Lysate | +Inquiry |
RPS27L-2164HCL | Recombinant Human RPS27L 293 Cell Lysate | +Inquiry |
IFT57-5273HCL | Recombinant Human IFT57 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All mug89 Products
Required fields are marked with *
My Review for All mug89 Products
Required fields are marked with *
0
Inquiry Basket