Recombinant Full Length Xenopus Laevis Glycerol-3-Phosphate Acyltransferase 3(Agpat9) Protein, His-Tagged
Cat.No. : | RFL12535XF |
Product Overview : | Recombinant Full Length Xenopus laevis Glycerol-3-phosphate acyltransferase 3(agpat9) Protein (Q68F37) (1-446aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Xenopus laevis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-446) |
Form : | Lyophilized powder |
AA Sequence : | MEDFKTIACNIFIIWLTLVIVLILLPSMFGSSLGISEVYMKILVKVLEWATLRIQKGFKD KEKLSASNGIIQRDKSPMETEIECLRQSRSQDIREGDFELGDVFYFAKKGFEAIVEDEVT QRFSSEELISWNLLTRTNNNFHYVSLRVTLIWVLGLCVRYCILLPLRITLATIGISWLVL GATLVGQLPNSRMKSWFSELVHLMCCRICARALSSAIQYHNKENKPKKGGICVANHTSPI DIIILANDGCYAMVGQVHGGLMGIIQRAMARACPHVWFERSEMRDRHLVTERLREHVSDK SKLPILIFPEGTCINNTSVMMFKKGSFEIGGTIYPVAIKYDPQFGDAFWNSSKNSMVSYL LRMMTSWALKCNVWYLPPVNRQDGEDAVQFANRVKSAIAKQGGLVELPWDGGLKRGKVKD SFKEEQQKNYSRIIAGENKSLKPTTH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | gpat3 |
Synonyms | gpat3; agpat9; Glycerol-3-phosphate acyltransferase 3; GPAT-3; 1-acyl-sn-glycerol-3-phosphate O-acyltransferase 10; AGPAT 10; 1-acyl-sn-glycerol-3-phosphate O-acyltransferase 9; 1-AGP acyltransferase 9; 1-AGPAT 9; Lysophosphatidic acid acyltransferase the |
UniProt ID | Q68F37 |
◆ Native Proteins | ||
VWF-17H | Native Human von Willebrand Factor, Factor VIII Free | +Inquiry |
Plg-5356M | Native Mouse Plg protein | +Inquiry |
CKM-368P | Native Pig Creatine Kinase, Muscle | +Inquiry |
CTSG-1649H | Active Native Human CTSG protein | +Inquiry |
ApoE-3560H | Native Human ApoE | +Inquiry |
◆ Cell & Tissue Lysates | ||
TFB1M-1136HCL | Recombinant Human TFB1M 293 Cell Lysate | +Inquiry |
CRELD2-001MCL | Recombinant Mouse CRELD2 cell lysate | +Inquiry |
ADCK1-10HCL | Recombinant Human ADCK1 lysate | +Inquiry |
AASDH-1HCL | Recombinant Human AASDH cell lysate | +Inquiry |
CCR9-310HCL | Recombinant Human CCR9 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All gpat3 Products
Required fields are marked with *
My Review for All gpat3 Products
Required fields are marked with *
0
Inquiry Basket