Recombinant Full Length Xenopus Laevis E3 Ubiquitin-Protein Ligase Synoviolin A(Syvn1-A) Protein, His-Tagged
Cat.No. : | RFL24166XF |
Product Overview : | Recombinant Full Length Xenopus laevis E3 ubiquitin-protein ligase synoviolin A(syvn1-a) Protein (Q6NRL6) (17-605aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Xenopus laevis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (17-605) |
Form : | Lyophilized powder |
AA Sequence : | YYLKNQFYPTVVYLTKSSPSMAVLYIQAFVLVFLLGKFMGKVFFGQLRAAEMEHLLERSW YAVTETCLAFTVFRDDFSPRFVALFTLLLFLKCFHWLAEDRVDFMERSPNISWLFHFRIL ALMLLLGVLDAFFVSHAYHSLVIRGASVQLVFGFEYAILMTVILTVFIKYILHSVDLQSE NPWDNKAVYMLYTELFTGFIKVLLYVAFMTIMVKVHTFPLFAIRPMYLAMRQFKKAVTDA IMSRRAIRNMNTLYPDATAEELQAMDNVCIICREEMVTGAKRLPCNHIFHTSCLRSWFQR QQTCPTCRMDVLRASLPTQPQTPTEQQNQHQNQAQQQPTPVIPPQPNFPPGILPPFPPGM FPLWPPMGPFPPVPGAPGGNPPDEANPGSSSGSSPRPGETSNVGSESQPGAALPGFPFPP PFLGMPILPPFGLPPMPMPPAGFTGLTDEELRAMEGHERQNLEARLQCLQNIHTLLDAAM LQINQYLTVLASIGPPQPPISSTSTSTSSAASASTAPTTSNISEPVIPVDTTSTVTNTES SQQSAPPAPVSVETLSGAEGGETTTEEPDNVELRRRRLQKLETGTTDSQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | syvn1-a |
Synonyms | syvn1-a; hrd1-a; E3 ubiquitin-protein ligase synoviolin A; RING-type E3 ubiquitin transferase synoviolin A; Synovial apoptosis inhibitor-1-A |
UniProt ID | Q6NRL6 |
◆ Recombinant Proteins | ||
Fcer1a-8688M | Recombinant Mouse Fcer1a protein(Met1-Gln204), hFc-tagged | +Inquiry |
DYNC1LI1-4145HF | Recombinant Full Length Human DYNC1LI1 Protein, GST-tagged | +Inquiry |
GALNT4-3452M | Recombinant Mouse GALNT4 Protein, His (Fc)-Avi-tagged | +Inquiry |
HENMT1-2066R | Recombinant Rhesus monkey HENMT1 Protein, His-tagged | +Inquiry |
UBC-4872Z | Recombinant Zebrafish UBC | +Inquiry |
◆ Native Proteins | ||
ATF-24B | Native Bovine Bovine Apo Transferrin | +Inquiry |
DPP4-31H | Active Native Human DPP4 | +Inquiry |
TF-93R | Native Rat Transferrin | +Inquiry |
CP-8074M | Native Mouse Serum Ceruloplasmin | +Inquiry |
LYZ-249H | Active Native Human Lysozyme | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZNF606-38HCL | Recombinant Human ZNF606 293 Cell Lysate | +Inquiry |
URM1-485HCL | Recombinant Human URM1 293 Cell Lysate | +Inquiry |
FCGR2A-1996HCL | Recombinant Human FCGR2A cell lysate | +Inquiry |
VDAC2-418HCL | Recombinant Human VDAC2 293 Cell Lysate | +Inquiry |
JAGN1-5108HCL | Recombinant Human JAGN1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All syvn1-a Products
Required fields are marked with *
My Review for All syvn1-a Products
Required fields are marked with *
0
Inquiry Basket