Recombinant Full Length Human DYNC1LI1 Protein, GST-tagged

• Cat.No.: DYNC1LI1-4145HF
• Product Overview: Human DYNC1LI1 full-length ORF (1 a.a. - 523 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: The protein encoded by this gene belongs to light intermediate subunit family, whose members are components of the multiprotein cytoplasmic dynein complex, which is involved in intracellular trafficking and chromosome segregation during mitosis. The protein plays a role in moving the spindle assembly checkpoint (SAC) from kinetochores to spindle poles. The protein may also mediate binding to other cargo molecules to facilitate intracellular vesicle trafficking. [provided by RefSeq, Jul 2016]
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 83 kDa
• Protein length: 523 amino acids
• AA Sequence: MAAVGRVGSFGSSPPGLSSTYTGGPLGNEIASGNGGAAAGDDEDGQNLWSCILSEVSTRSRSKLPAGKNVLLLGEDGAGKTSLIRKIQGIEEYKKGRGLEYLYLNVHDKDRDDQTRCNVWILDGDLYHKGLLKFSLDAVSLKDTLVMLVVDMSKPWTALDSLQKWASVVREHVDKLKIPPEEMKQMEQKLIRDFQEYVEPGEDFPASPQRRNTASQEDKDDSVVLPLGADTLTHNLGIPVLVVCTKCDAISVLEKEHDYRDEHFDFIQSHIRKFCLQYGAALIYTSVKENKNIDLVYKYIVQKLYGFPYKIPAVVVEKDAVFIPAGWDNDKKIGILHENFQTLKAEDNFEDIITKPPVRKFVHEKEIMAEDDQVFLMKLQSLLAKQPPTAAGRPVDASPRVPGGSPRTPNRSVSSNVASVSPIPAGSKKIDPNMKAGATSEGVLANFFNSLLSKKTGSPGGPGVSGGSPAGGAGGGSSGLPPSTKKSGQKPVLDVHAELDRITRKPVTVSPTTPTSPTEGEAS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DYNC1LI1 dynein, cytoplasmic 1, light intermediate chain 1 [ Homo sapiens ]
• Official Symbol: DYNC1LI1
• Synonyms: DYNC1LI1; dynein, cytoplasmic 1, light intermediate chain 1; DNCLI1, dynein, cytoplasmic, light intermediate polypeptide 1; cytoplasmic dynein 1 light intermediate chain 1; DLC-A; dynein light chain A; dynein light chain-A; dynein light intermediate chain 1, cytosolic; dynein, cytoplasmic, light intermediate polypeptide 1; LIC1; DNCLI1; FLJ10219
• Gene ID: 51143
• mRNA Refseq: NM_016141
• Protein Refseq: NP_057225
• MIM: 615890
• UniProt ID: Q9Y6G9