Recombinant Full Length Xenopus Laevis E3 Ubiquitin-Protein Ligase Rnf149(Rnf149) Protein, His-Tagged
Cat.No. : | RFL32718XF |
Product Overview : | Recombinant Full Length Xenopus laevis E3 ubiquitin-protein ligase RNF149(rnf149) Protein (Q6NRX0) (21-397aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Xenopus laevis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (21-397) |
Form : | Lyophilized powder |
AA Sequence : | RSLEWFTALVRTEYTEPLTNSSVTGSTESGRYGDSSPKESVKGFVGYPRDPWQLEGCHPD TQYIVPGTSAAAAAGPDSEWTQPWIALVARGGCTFKEKVFNAANRGASAVVIYNEAKSGN ATVSMSHLGTGNTVVIMVSYPKGMEIMEPLRRDIPVKMVITVGTRHVQEFISGQSVVFVA IAFITMMIISLAWLIFYYIQRFLYTGAQCGNQSNRKETKKAISQLQLHRVKKGEKGIDID AENCAVCIENYKTKDLVRILPCKHIFHRLCIDPWLIEHRTCPMCKLDVIKALGFWVEPEE TLDIHVPDSIAGSSLSIGTVSITQEESRSEGNNLPSSSTGSSLQQSNSVKDDAGETTALL DDPGNDNAAATHTQDSH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | rnf149 |
Synonyms | rnf149; E3 ubiquitin-protein ligase RNF149; RING finger protein 149; RING-type E3 ubiquitin transferase RNF149 |
UniProt ID | Q6NRX0 |
◆ Recombinant Proteins | ||
TGFBR3-5911C | Recombinant Chicken TGFBR3 | +Inquiry |
RFL7056BF | Recombinant Full Length Burkholderia Multivorans Glycerol-3-Phosphate Acyltransferase(Plsy) Protein, His-Tagged | +Inquiry |
ACTR1B-26592TH | Recombinant Human ACTR1B, His-tagged | +Inquiry |
PSMC6-6043H | Recombinant Human PSMC6 Protein (Met1-Val389), N-His tagged | +Inquiry |
NR2F6-1959H | Recombinant Human NR2F6 Protein (1-404 aa), His-SUMO-tagged | +Inquiry |
◆ Native Proteins | ||
OVAL-140C | Native Chicken ovalbumin | +Inquiry |
TTR-141S | Native Sheep prealbumin | +Inquiry |
Fgg-5421R | Native Rat Fibrinogen Gamma Chain | +Inquiry |
Thrombin-23B | Native Bovine Thrombin | +Inquiry |
C. albicans-38 | Native Candida albicans Antigen | +Inquiry |
◆ Cell & Tissue Lysates | ||
MSL1-423HCL | Recombinant Human MSL1 lysate | +Inquiry |
LRRN1-4619HCL | Recombinant Human LRRN1 293 Cell Lysate | +Inquiry |
Precentral Gyrus-399H | Human Precentral Gyrus (Alzheimers Disease) Lysate | +Inquiry |
CNOT2-7403HCL | Recombinant Human CNOT2 293 Cell Lysate | +Inquiry |
HNRPLL-5438HCL | Recombinant Human HNRPLL 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All rnf149 Products
Required fields are marked with *
My Review for All rnf149 Products
Required fields are marked with *
0
Inquiry Basket