Recombinant Full Length Xenopus Laevis Ceramide Glucosyltransferase-B(Ugcg-B) Protein, His-Tagged
Cat.No. : | RFL33482XF |
Product Overview : | Recombinant Full Length Xenopus laevis Ceramide glucosyltransferase-B(ugcg-b) Protein (Q5U4S8) (1-394aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Xenopus laevis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-394) |
Form : | Lyophilized powder |
AA Sequence : | MAVLDLALQGLAIFGCILFFVLWFMHFLSIVYTRLHLNKKVSDKQPYSKLPGVSLLKPLK GVDSNLINNLETFFELDYPKFEILLCVQDLDDPAVDVCKKLLGKYPSVDAKLFIGGKKVG INPKINNLMPGYEVAKYDLIWICDSGIKVKPDTLTDMANQMTEKVGLVHGLPYVADRQGF AATLEQVYFGTSHPRSYISANVTGIKCVTGMSCLMRKEVLDQAGGLIAFAQYIAEDYFMA KAIADRGWKFSMATQVAMQNSGCYSISQFQSRMIRWAKLRINMLPATIICEPISECFVAS LIIGWAAHHIFRWDIMVFFMCHCLAWFIFDYIQLRGVQGGPLNFSKLDYAVAWFIRESMT IYIFLSALWDPTISWRTGRYRLRCGGTAEEILDV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ugcg-b |
Synonyms | ugcg-b; ugcg; Ceramide glucosyltransferase-B; UDP-glucose ceramide glucosyltransferase |
UniProt ID | Q5U4S8 |
◆ Recombinant Proteins | ||
LOC541469-4668H | Recombinant Human LOC541469 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CCL13-288H | Recombinant Human CCL13 protein | +Inquiry |
Defb6-5332M | Recombinant Mouse Defb6 protein, GST-tagged | +Inquiry |
MPXV-0274 | Recombinant Monkeypox Virus B7R Protein, Ankyrin-like Protein (B7R) | +Inquiry |
Egfl7-4033M | Recombinant Mouse Egfl7 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1812P | Active Native Peanut Lectin Protein, Agarose Bound | +Inquiry |
Mb-8232R | Native Rat Myoglobin | +Inquiry |
APOB-1H | Native Human Apolipoprotein B | +Inquiry |
MDH-38P | Active Native Porcine Malate dehydrogenase | +Inquiry |
Urease-52J | Active Native Jack Bean Urease | +Inquiry |
◆ Cell & Tissue Lysates | ||
PDHA2-3333HCL | Recombinant Human PDHA2 293 Cell Lysate | +Inquiry |
TPP1-449HCL | Recombinant Human TPP1 cell lysate | +Inquiry |
ASPN-138HCL | Recombinant Human ASPN cell lysate | +Inquiry |
PTCH1-2723HCL | Recombinant Human PTCH1 293 Cell Lysate | +Inquiry |
MAPK10-4498HCL | Recombinant Human MAPK10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All ugcg-b Products
Required fields are marked with *
My Review for All ugcg-b Products
Required fields are marked with *
0
Inquiry Basket