Recombinant Full Length Xenopus Laevis Bladder Cancer-Associated Protein B(Blcap-B) Protein, His-Tagged
Cat.No. : | RFL32210XF |
Product Overview : | Recombinant Full Length Xenopus laevis Bladder cancer-associated protein B(blcap-b) Protein (Q5EAT6) (1-87aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Xenopus laevis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-87) |
Form : | Lyophilized powder |
AA Sequence : | MYCLQWLLPVLLIPKPLNPALWFSHSVFMGFYLLSFLLERKPCTICALVFLGALFLICYS CWGNCFLYHCSASELPEAAYDPAVVGT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | blcap-b |
Synonyms | blcap-b; Bladder cancer-associated protein B |
UniProt ID | Q5EAT6 |
◆ Recombinant Proteins | ||
ENO2-171HFL | Recombinant Full Length Human ENO2 Protein, C-Flag-tagged | +Inquiry |
SENP3-8015M | Recombinant Mouse SENP3 Protein, His (Fc)-Avi-tagged | +Inquiry |
ITSN2-193H | Recombinant Human ITSN2, GST-tagged | +Inquiry |
LRRN1-4561H | Recombinant Human LRRN1 protein, His-SUMO-tagged | +Inquiry |
RIMKLB-4036H | Recombinant Human RIMKLB Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
LDL-394H | Native Human Low Density Lipoprotein, Biotin labeled | +Inquiry |
Lectin-1720P | Native Peanut Lectin, Biotin conjugated | +Inquiry |
LDH4-23H | Active Native Human Lactate Dehydrogenase 4 | +Inquiry |
CA50-01H | Active Native Human Cancer Antigen 50 protein | +Inquiry |
GS-32 | Active Native Glutamine synthetase | +Inquiry |
◆ Cell & Tissue Lysates | ||
TRIM4-776HCL | Recombinant Human TRIM4 293 Cell Lysate | +Inquiry |
EIF2AK3-6673HCL | Recombinant Human EIF2AK3 293 Cell Lysate | +Inquiry |
Stomach-485G | Guinea Pig Stomach Lysate | +Inquiry |
CES5A-2231MCL | Recombinant Mouse CES5A cell lysate | +Inquiry |
PEMT-3301HCL | Recombinant Human PEMT 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All blcap-b Products
Required fields are marked with *
My Review for All blcap-b Products
Required fields are marked with *
0
Inquiry Basket