Recombinant Full Length Xanthomonas Oryzae Pv. Oryzae Undecaprenyl-Diphosphatase(Uppp) Protein, His-Tagged
Cat.No. : | RFL33786XF |
Product Overview : | Recombinant Full Length Xanthomonas oryzae pv. oryzae Undecaprenyl-diphosphatase(uppP) Protein (Q2NXJ3) (1-265aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Xanthomonas oryzae pv. oryzae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-265) |
Form : | Lyophilized powder |
AA Sequence : | MSDLISALLLGILEGLTEFLPISSTGHLLIAEQWLGRRSDFFNIVIQAGAILAICLALRQ RLWTLATGLGERDNRDYVLKVSVAFLVTAVVGLIVRKAGWQLPETLQPVAWALLIGGVWM LVAEHVAGKLPERDVVTWKVAIAVGLAQVVAGVFPGTSRSASTIFIAMLLGLSRRSAAAD FVFMVGIPTMFAASGYALLEMYKEGGFGTEHWADVAVAFVAATITGFVVVKWLLSYIKKH RFTVFAVYRIVLGAALLLWLPAAAG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | uppP |
Synonyms | uppP; XOO4229; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase |
UniProt ID | Q2NXJ3 |
◆ Recombinant Proteins | ||
ENOSF1-3318H | Recombinant Human ENOSF1 Protein, GST-tagged | +Inquiry |
Erbb2-4097RP | Recombinant Rat Erbb2 protein, Fc-tagged, R-PE labeled | +Inquiry |
PTPN1-3521R | Recombinant Rhesus Macaque PTPN1 Protein, His (Fc)-Avi-tagged | +Inquiry |
KLHL21-3281R | Recombinant Rat KLHL21 Protein | +Inquiry |
CCDC53-10519Z | Recombinant Zebrafish CCDC53 | +Inquiry |
◆ Native Proteins | ||
ALB-320H | Native Human Albumin Rhodamine | +Inquiry |
Neuraminidase-008C | Active Native Clostridium perfringens Neuraminidase, Type V | +Inquiry |
Ferritin-179H | Native Human Ferritin | +Inquiry |
Lectin-1857V | Active Native Vicia Villosa Lectin Protein, Fluorescein labeled | +Inquiry |
HB-41D | Native Dog Hemoglobin (HB) Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
NP-002HCL | Recombinant H3N2 NP cell lysate | +Inquiry |
VPS35-389HCL | Recombinant Human VPS35 293 Cell Lysate | +Inquiry |
GK-5913HCL | Recombinant Human GK 293 Cell Lysate | +Inquiry |
TRMT12-755HCL | Recombinant Human TRMT12 293 Cell Lysate | +Inquiry |
CD53-1018CCL | Recombinant Cynomolgus CD53 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All uppP Products
Required fields are marked with *
My Review for All uppP Products
Required fields are marked with *
0
Inquiry Basket