Recombinant Full Length Xanthomonas Oryzae Pv. Oryzae Probable Ubiquinone Biosynthesis Protein Ubib(Ubib) Protein, His-Tagged
Cat.No. : | RFL11330XF |
Product Overview : | Recombinant Full Length Xanthomonas oryzae pv. oryzae Probable ubiquinone biosynthesis protein UbiB(ubiB) Protein (Q2P8Q0) (1-557aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Xanthomonas oryzae pv. oryzae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-557) |
Form : | Lyophilized powder |
AA Sequence : | MKAILRASRIGRVILRYRLDALLEGTPAERWLRLAKPFVPRASAEIAVQSRGARLRLALQ ELGPIFVKFGQILSTRRDLIPADVAEELTLLQDRVKPFDGEAARLIVERALGLPVSVAFA SFDTVPLASASIAQVHAATLPPDANGVRREVVVKVLRPEIERQIDADIALLHSLATLVER THPRADKIRPREVVAEIEGTLSAELDLQREGANASVLRRFWEGSDDLYVPEVIWSHTAER ALTLERVYGIPSDDIAKLDAAGIDRKALAAKGVRVFYTQVFRDNFFHADAHAGNIWVDSD PERRLNPRFIALDFGIMGQLSQEDQYYLAENFMAIFHKDYRRMAELHVEAGWMPSNVRID ELEAAARSVCEPYFTRPLSEISLAQVLIKLFRVAQRYELTLQPQLILLQKTLLNIEGVGR QLDPKLDIWAVARPVLERILRERYSPRRVLRELSKRLPEIMTHAPDMPRLVHSWLKQQVE GRHQIDIRSTELLALDLSLRKLQTRVVTAITGSGLLVVAAVLYGLHPDGWYLGTVPVWSW ISGGAGSAALLVAWLRR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ubiB |
Synonyms | ubiB; XOO0322; Probable protein kinase UbiB; Ubiquinone biosynthesis protein UbiB |
UniProt ID | Q2P8Q0 |
◆ Recombinant Proteins | ||
FAM221B-1898R | Recombinant Rat FAM221B Protein, His (Fc)-Avi-tagged | +Inquiry |
Sele-164M | Recombinant Mouse Sele Protein, His (Fc)-Avi-tagged | +Inquiry |
CFP21-2292M | Recombinant Mycobacterium Tuberculosis CFP21 Protein (33-217 aa), His-SUMO-Myc-tagged | +Inquiry |
IL4I1-3716C | Recombinant Chicken IL4I1 | +Inquiry |
RFL5154CF | Recombinant Full Length Polypeptide N-Acetylgalactosaminyltransferase 3(Gly-3) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1856V | Active Native Vicia Villosa Lectin Protein, Biotinylated | +Inquiry |
Complement C1s-44H | Native Human Complement C1s | +Inquiry |
CHOD-22 | Active Native Cholesterol esterase | +Inquiry |
PLG-55H | Native Human lys-Plasminogen | +Inquiry |
AFP-3018P | Native pig AFP | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNFRSF17-2489HCL | Recombinant Human TNFRSF17 cell lysate | +Inquiry |
SLITRK4-1719HCL | Recombinant Human SLITRK4 cell lysate | +Inquiry |
HS3ST1-5387HCL | Recombinant Human HS3ST1 293 Cell Lysate | +Inquiry |
GDPGP1-1012HCL | Recombinant Human GDPGP1 cell lysate | +Inquiry |
CPSF3-7304HCL | Recombinant Human CPSF3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ubiB Products
Required fields are marked with *
My Review for All ubiB Products
Required fields are marked with *
0
Inquiry Basket