Recombinant Full Length Xanthomonas Campestris Pv. Campestris Upf0761 Membrane Protein Xcc-B100_3490 (Xcc-B100_3490) Protein, His-Tagged
Cat.No. : | RFL9816XF |
Product Overview : | Recombinant Full Length Xanthomonas campestris pv. campestris UPF0761 membrane protein xcc-b100_3490 (xcc-b100_3490) Protein (B0RUB3) (1-425aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Xanthomonas Campestris Pv. Campestris |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-425) |
Form : | Lyophilized powder |
AA Sequence : | MSRVNTMHQWKERLRDRARTASFGRFLWRRFLDDRLFQAAASLAYTTVFALVPLAIVVFG VLSAFPAFNEWKDALTDFIFNNFVPGAARSVQNYLNRSLEDLGKFTVAGMVALVASLLIT LHSIEQTFNSIWRVAAARPKVTRFLIYWTVLTLGTMLAAASMAMAAYVFALPLFRTTEGQ WLAEFAWRLAPMAVEFVCIVLIYRVVPQHAVRLRHALPGALLAVILMEIVKWGFGFYLGN FQTYQRIYGALSALPILLLWIYLSWVSVLLGASLASSMSAFRYQPEAMRLPPGFEIYGLL RLLGRFRQARLHGNGLDEDRILALEPMLTDTLMQELLCELKRIRLLRRDERSNWLLARDL DVVPLAELYESCQLRVPVEDRPLPCRDDPYGQAAAAALEQLRQPLRSVLAQPVGDLYTHL PGDPP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | xcc-b100_3490 |
Synonyms | xcc-b100_3490; UPF0761 membrane protein xcc-b100_3490 |
UniProt ID | B0RUB3 |
◆ Recombinant Proteins | ||
Prdx5-2545M | Active Recombinant Mouse Prdx5 protein, His-tagged | +Inquiry |
Ntf5-323N | Active Recombinant Mouse Ntf5 Protein (131 aa) | +Inquiry |
KIT-85H | Active Recombinant Human c-KIT Mutant (T670E), GST-tagged | +Inquiry |
Fktn-4255M | Recombinant Mouse Fktn protein, His&Myc-tagged | +Inquiry |
MCM5-4520H | Recombinant Human MCM5 Protein (Val331-Ile537), N-His tagged | +Inquiry |
◆ Native Proteins | ||
Troponin-18H | Native Human Cardiac Troponin complex | +Inquiry |
Fxa-66R | Native Rat Factor Ixa | +Inquiry |
slo-01S | Active Native Streptococcus pyogenes Streptolysin O protein | +Inquiry |
IgG-348G | Native Hamster Gamma Globulin Fraction | +Inquiry |
Luciferase-10V | Native Vibrio fischeri Luciferase | +Inquiry |
◆ Cell & Tissue Lysates | ||
Fetal Brain-131H | Human Fetal Brain Membrane Lysate | +Inquiry |
SPRR2A-1494HCL | Recombinant Human SPRR2A 293 Cell Lysate | +Inquiry |
RNF40-2275HCL | Recombinant Human RNF40 293 Cell Lysate | +Inquiry |
Fetal Duodenum-139H | Human Fetal Duodenum Lysate | +Inquiry |
NDNF-8030HCL | Recombinant Human C4orf31 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All xcc-b100_3490 Products
Required fields are marked with *
My Review for All xcc-b100_3490 Products
Required fields are marked with *
0
Inquiry Basket