Active Recombinant Mouse Ntf5 Protein (131 aa)

• Cat.No.: Ntf5-323N
• Product Overview: Recombinant mouse Neurotrophin-4 (rmNT-4) produced in E. coli is a noncovalently linked homodimer containing two non-glycosylated polypeptide chainsof 131 amino acids. A fully biologically active molecule, rmNT-4 has a molecular mass of 14.0kDaanalyzed by reducing SDS-PAGE and is obtained by proprietary chromatographic techniques.

Specification

• Description: Neurotrophin-4 (NT-4) is a small secreted cytokine, and belongs to the Neurotrophin (NT) family, which also includes Brain Derived Neurotropic Factor (BDNF), Nerve Growth Factor (NGF), and NT-3. NT family members are all derived from similar sized protein precursors, composed of N-terminal propeptides and C-terminal mature domains, which are separated by posttranslational proteolytic cleavage. NT-4 (along with NT-3) is foundin the brains of mammals. In vivo, NT-4 binds to the common receptor, p75NTR, and a tyrosine kinase receptor, TrkB. The heterotrimeric complex activates the NFκB transcription factor. NT-4 is essential for the differentiation and wiring regulation of the central and peripheral nervous systems during development, and is related to important diseases including Alzheimer's.
• Source: E. coli
• Species: Mouse
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: ED50 < 1 μg/mL, measured by a cell proliferation assay usingC6cells, corresponding to a specific activity of>1 × 10^3 units/mg.
• Molecular Mass: 14.0 kDa, observed by reducing SDS-PAGE.
• Protein length: 131
• AA Sequence: MGVSETAPASRRGELAVCDAVSGWVTDRRTAVDLRGREVEVLGEVPAAGGSPLRQYFFETRCKAESAGEGGPGVGGGGCRGVDRRHWLSECKAKQSYVRALTADSQGRVGWRWIRIDTACVCTLLSRTGRA
• Endotoxin: < 0.2 EU/μg, determined by LAL method.
• Purity: > 95% by SDS-PAGEanalysis.
• Storage: Lyophilized recombinant mouse Neurotrophin-4 (rmNT-4) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rmNT-4 remains stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against 50mM acetic acid.
• Reconstitution: Reconstituted in 50mM acetic acid or ddH2O at 100 μg/mL.

Gene Information

• Gene Name: Ntf5 neurotrophin 5 [ Mus musculus (house mouse) ]
• Official Symbol: Ntf5
• Synonyms: Ntf5; neurotrophin 5; NT4; NT-4; NT-5; Ntf4; NT4/5; Ntf-5; 2900040K06Rik; neurotrophin-4; neutrophic factor 4
• Gene ID: 78405
• mRNA Refseq: NM_198190
• Protein Refseq: NP_937833
• UniProt ID: Q80VU4