Recombinant Full Length Xanthomonas Campestris Pv. Campestris Phosphoglycerol Transferase I(Opgb) Protein, His-Tagged
Cat.No. : | RFL31353XF |
Product Overview : | Recombinant Full Length Xanthomonas campestris pv. campestris Phosphoglycerol transferase I(opgB) Protein (Q8PDD7) (1-702aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Xanthomonas Campestris Pv. Campestris |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-702) |
Form : | Lyophilized powder |
AA Sequence : | MHWILALSLLLLLLLLVASPRLAWLKAGLLSLLLLLLSAWGLVDRLSGDGVNAATLYHLR ADMDGAGVSDFSGYIAVFIGMVLLSLSPLVLLRVRRFRRPRGGGAVFGAFVVMLLVSVAV SPLYRDGKRLYYQLRPVDYATVVPEYQVPQQPLQKRKNIVWIYGESLERTYFDEATFPGL MPNLHQLATEAVDVRNLTSTEGSGWTIAGMVASMCGVPLTTAPGDENSMGRMGLFLPEAR CLGDYLKDQGYRNHYVGGADASFAGKGSFLASHGFDVVHDVNYFHDKGVAPKHFSAWGVH DDVLLDDAWDSFQTLSRAGQPFMLTTLTMDTHHPAGHLPLACKNQRYESPLGDIGLLHAI KCSDRLIGRLVTRIRNSRYGRNTIIVIASDHLAMPNDLSDVLAKQKRENLLLFLGKDIPP QQVVTRAGSTLDSGATLLQLLEPGMRTLGFGRSLLANDAPPSASVAASRDSGKNYPRYLA YARTLWTGRSTRMLRVNGNGDVVVGVQQVRPPVLLEYDDNTNLKTVYLENTSRQFDRTHS DGTLAYVDRCTAFEDGSADGDWCALVVDRNQHMKLYRDPDLTRGIAVDAPLDVTPQAPRP RVRQPIMLTQAARKTEAGRYMLELYAKRRPTRAFWVEAVSSERKVVLAQQWVVPDASGRI RMPVGLEHAVEDLEIRAWLDYTEEVSVDDLALVKDTAVADRS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | opgB |
Synonyms | opgB; mdoB; XCC0403; Phosphoglycerol transferase I; Phosphatidylglycerol--membrane-oligosaccharide glycerophosphotransferase |
UniProt ID | Q8PDD7 |
◆ Recombinant Proteins | ||
FRZB-1874H | Recombinant Human FRZB protein, GST-tagged | +Inquiry |
NID2-10662M | Recombinant Mouse NID2 Protein | +Inquiry |
ERA-3240S | Recombinant Staphylococcus epidermidis ATCC 12228 ERA protein, His-tagged | +Inquiry |
Tnni2-6568M | Recombinant Mouse Tnni2 Protein, Myc/DDK-tagged | +Inquiry |
PRPS1-3444R | Recombinant Rhesus Macaque PRPS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
TIMP1-30840TH | Native Human TIMP1 | +Inquiry |
FGF1-33B | Active Native Bovine FGF1 | +Inquiry |
IgA-259H | Native Human Secretory Immunoglobulin A | +Inquiry |
IgG-340G | Native Goat IgG | +Inquiry |
HDL-398H | Native Human High Density Lipoprotein, DiO labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
ROCK2-2255HCL | Recombinant Human ROCK2 293 Cell Lysate | +Inquiry |
ATP5H-8599HCL | Recombinant Human ATP5H 293 Cell Lysate | +Inquiry |
VSIG8-001HCL | Recombinant Human VSIG8 cell lysate | +Inquiry |
FCGR2A-001HCL | Recombinant Human FCGR2A cell lysate | +Inquiry |
ERGIC3-6556HCL | Recombinant Human ERGIC3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All opgB Products
Required fields are marked with *
My Review for All opgB Products
Required fields are marked with *
0
Inquiry Basket