Recombinant Full Length Xanthomonas Campestris Pv. Campestris Phosphoglycerol Transferase I(Opgb) Protein, His-Tagged
Cat.No. : | RFL19752XF |
Product Overview : | Recombinant Full Length Xanthomonas campestris pv. campestris Phosphoglycerol transferase I(opgB) Protein (B0RMT0) (1-702aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Xanthomonas Campestris Pv. Campestris |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-702) |
Form : | Lyophilized powder |
AA Sequence : | MHWILALSLLLLLWLLVASPRLAWLKAGLLSLLLLLLSAWGLVDRLSGDGINAATLYHLR ADMDGAGVSDFSGYIAVFIGMVLLSLSPLMLLRVRRFRRPRGGGAVFGAFVVMLLVSMAV SPVYRDGKRLYYQLRPVDYATVVPEYQVPQQPLQKRKNIVWIYGESLERTYFDEATFPGL MPNLRQLATEAVDVRNLTSTEGSGWTIAGMVASMCGVPLTTAPGDENSMGRMGLFLPEAR CLGDYLKDQGYRNHYVGGADASFAGKGSFLASHGFDVVHDVNYFHDKGVAPKHFSAWGVH DDVLLDDAWESFQTLSRAGQPFMLTTLTMDTHHPAGHLPLACKNQRYESPLGDIGLLHAI KCSDRLIGELVTRIRNSRYGRNTIIVIASDHLAMPNDLSDVLAKQKRENLLLFLGKDIPP QQVVRRAGSTLDSGATLLQLLEPGMRTLGFGRSLLANDAPPSASVAASRDSGRDYPRYLA YARTLWTGRSTRMLRVNGNGDVVVGVQQVRPPVLLEYDDDTNLKTVYLENTSRQFDRTHS DGTLAYVDRCTAFEDGSADGDWCALVVDRNQHMKLYRDPDLTRGIAVDAPLDVTPQAPRP RVRQPIMLTQAARKTEAGRYMLELYAKRRPTRAFWVEAVSSERKVVLAQQWVVPDASGRI RMPVGLEHAVEDLGIRAWLDYTEEVSVDDLALVKDTAVADRS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | opgB |
Synonyms | opgB; xcc-b100_0434; Phosphoglycerol transferase I; Phosphatidylglycerol--membrane-oligosaccharide glycerophosphotransferase |
UniProt ID | B0RMT0 |
◆ Recombinant Proteins | ||
UGT2B33-5101R | Recombinant Rhesus monkey UGT2B33 Protein, His-tagged | +Inquiry |
ANXA2R-380H | Recombinant Human ANXA2R Protein, GST-His-tagged | +Inquiry |
SSEG-RS25320-533S | Recombinant Streptomyces sviceus ATCC 29083 SSEG_RS25320 protein, His-tagged | +Inquiry |
Retnlb-1940M | Recombinant Mouse Retnlb protein, His & GST-tagged | +Inquiry |
kshB-1434M | Recombinant Mycobacterium tuberculosis kshB Protein (M1-E358), His-tagged | +Inquiry |
◆ Native Proteins | ||
pepsin -173P | Native Pig pepsin | +Inquiry |
LDL-246H | Native Human Lipoproteins, Oxidized LDL (OX-LDL) | +Inquiry |
PLG-252H | Active Native Human Plasminogen | +Inquiry |
CED026 | Active Bovine Superoxide Dismutase (SOD), High Purity >95% | +Inquiry |
Serpinc1-298M | Active Native Mouse Antithrombin III | +Inquiry |
◆ Cell & Tissue Lysates | ||
MAVS-1909HCL | Recombinant Human MAVS cell lysate | +Inquiry |
GDAP2-5972HCL | Recombinant Human GDAP2 293 Cell Lysate | +Inquiry |
MATN2-4449HCL | Recombinant Human MATN2 293 Cell Lysate | +Inquiry |
MTHFD2-4083HCL | Recombinant Human MTHFD2 293 Cell Lysate | +Inquiry |
C20orf7-8112HCL | Recombinant Human C20orf7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All opgB Products
Required fields are marked with *
My Review for All opgB Products
Required fields are marked with *
0
Inquiry Basket