Recombinant Full Length Xanthomonas Campestris Pv. Campestris C4-Dicarboxylate Transport Protein(Dcta) Protein, His-Tagged
Cat.No. : | RFL25380XF |
Product Overview : | Recombinant Full Length Xanthomonas campestris pv. campestris C4-dicarboxylate transport protein(dctA) Protein (Q8P5J5) (1-448aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Xanthomonas Campestris Pv. Campestris |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-448) |
Form : | Lyophilized powder |
AA Sequence : | MHISKPAGPLPAPVPFYRQLYFQVVVAIVLGALLGHFEPAFAESLKPLGDAFIKLVKMII APVIFLTIVTGIAGMTHLKTVGRVFAKSMTYFLFFSTLALIVGMVVAHVVQPGAGMNINP AELDQSAVNTYVQKSHELSLVGFLMDIIPATLISAFVDGNILQVLFVAVLFGIALALVGE RGRPVLSFLEALTAPVFRLVHMLMKAAPIGAFGAIAFTIGKYGVESLVNLAWLVGSFYLT SLFFVLVILGIVCRLCGFSVLKLIRYLKAELLLVLGTSSSESALPSLMEKMEKAGCEKSV VGLVVPTGYSFNLDGTNIYMTLAALFIAQATNVDLTLGQQITLLAVAMLSSKGAAGVTGA GFITLAATLSVVPDVPVAGMALILGVDRFMSECRSLTNFIGNAVATVVVSRWENALDRDQ LSLALDGRAPPLQAPVPPPDAVAPVSAR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | dctA |
Synonyms | dctA; XCC3346; C4-dicarboxylate transport protein |
UniProt ID | Q8P5J5 |
◆ Recombinant Proteins | ||
FABP2-3697H | Recombinant Human FABP2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SH-RS03070-5732S | Recombinant Staphylococcus haemolyticus JCSC1435 SH_RS03070 protein, His-tagged | +Inquiry |
PAF1-3783H | Recombinant Human PAF1 Protein, His (Fc)-Avi-tagged | +Inquiry |
GSS-2731R | Recombinant Rat GSS Protein | +Inquiry |
RFL2076SF | Recombinant Full Length Atp Synthase Subunit C(Atpe) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
PRSS1-30745TH | Active Native Human PRSS1 | +Inquiry |
F2-277B | Active Native Bovine α-Thrombin-BFPRck (Biotin) | +Inquiry |
Lectin-1804L | Active Native Lycopersicon Esculentum Lectin Protein, DyLight 649 labeled | +Inquiry |
Lectin-1809M | Active Native Maackia Amurensis Lectin II Protein, Biotinylated | +Inquiry |
HRP-8336h | Active Native horseradish HRP | +Inquiry |
◆ Cell & Tissue Lysates | ||
LYNX1-4595HCL | Recombinant Human LYNX1 293 Cell Lysate | +Inquiry |
PROM1-981RCL | Recombinant Rat PROM1 cell lysate | +Inquiry |
WIPI2-309HCL | Recombinant Human WIPI2 293 Cell Lysate | +Inquiry |
PPP1R2P9-1402HCL | Recombinant Human PPP1R2P9 cell lysate | +Inquiry |
PMFBP1-1382HCL | Recombinant Human PMFBP1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All dctA Products
Required fields are marked with *
My Review for All dctA Products
Required fields are marked with *
0
Inquiry Basket