Recombinant Full Length Xanthomonas Campestris Pv. Campestris C4-Dicarboxylate Transport Protein(Dcta) Protein, His-Tagged
Cat.No. : | RFL28747XF |
Product Overview : | Recombinant Full Length Xanthomonas campestris pv. campestris C4-dicarboxylate transport protein(dctA) Protein (B0RP10) (1-448aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Xanthomonas Campestris Pv. Campestris |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-448) |
Form : | Lyophilized powder |
AA Sequence : | MHISKPAGPLPAPVPFYRQLYFQVVVAIVLGALLGHFEPAFAESLKPLGDAFIKLVKMII APVIFLTIVTGIAGMTHLKTVGRVFAKSMTYFLFFSTLALIVGMVVAHVVQPGAGMNINP AELDQSAVNTYVQKSHELSLVGFLMDIIPATLISAFVDGNILQVLFVAVLFGIALALVGE RGRPVLSFLEALTAPVFRLVHMLMKAAPIGAFGAIAFTIGKYGVESLVNLAWLVGSFYLT SLFFVLVILGIVCRLCGFSVLKLIRYLKAELLLVLGTSSSESALPSLMEKMEKAGCEKSV VGLVVPTGYSFNLDGTNIYMTLAALFIAQATNVDLTLGQQITLLAVAMLSSKGAAGVTGA GFITLAATLSVVPDVPVAGMALILGVDRFMSECRSLTNFIGNAVATVVVSRWENALDRDQ LSLALDGRAPPLQAPVPPPDAVAPVSAR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | dctA |
Synonyms | dctA; xcc-b100_0852; C4-dicarboxylate transport protein |
UniProt ID | B0RP10 |
◆ Recombinant Proteins | ||
GCA-26242TH | Recombinant Human GCA, His-tagged | +Inquiry |
RFL7148DF | Recombinant Full Length Danio Rerio Sphingomyelin Phosphodiesterase 4(Smpd4) Protein, His-Tagged | +Inquiry |
TFDP2-3199H | Recombinant Human TFDP2, GST-tagged | +Inquiry |
CENPM-15887H | Recombinant Human CENPM, His-tagged | +Inquiry |
IL1F5-237B | Recombinant Bovine Interleukin 1 Family, Member 5 (Delta) | +Inquiry |
◆ Native Proteins | ||
GlycoProtein G-11H | Native HSV-2 GlycoProtein G | +Inquiry |
Staphylococcus aureus-01 | Native S. aureus Suspension (Wood 46 strain) | +Inquiry |
GPT-187H | Active Native Human Glutamate Pyruvate Transaminase | +Inquiry |
HMGB1-8447B | Active Native Bovine HMGB1 | +Inquiry |
Transglutaminase-88G | Active Native Guinea pig liver Transglutaminase | +Inquiry |
◆ Cell & Tissue Lysates | ||
Colon-511D | Dog Colon Lysate, Total Protein | +Inquiry |
NOX1-3751HCL | Recombinant Human NOX1 293 Cell Lysate | +Inquiry |
EPHA4-1446RCL | Recombinant Rat EPHA4 cell lysate | +Inquiry |
GAMT-684HCL | Recombinant Human GAMT cell lysate | +Inquiry |
ATAD1-44HCL | Recombinant Human ATAD1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All dctA Products
Required fields are marked with *
My Review for All dctA Products
Required fields are marked with *
0
Inquiry Basket