Recombinant Full Length Xanthomonas Axonopodis Pv. Citri C4-Dicarboxylate Transport Protein(Dcta) Protein, His-Tagged
Cat.No. : | RFL19928XF |
Product Overview : | Recombinant Full Length Xanthomonas axonopodis pv. citri C4-dicarboxylate transport protein(dctA) Protein (Q8PGZ1) (1-457aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Xanthomonas axonopodis pv. citri |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-457) |
Form : | Lyophilized powder |
AA Sequence : | MHISKPAGPLPASVPFYRQLYFQVVVAIVLGALLGHFEPAFAESLKPLGDAFIKLVKMII APVIFLTIVTGIAGMTHLKTVGRVFGKAMAYFLFFSTLALVVGLVVAHVVQPGAGMNINP ADLDQSAVKSYVEKSHDLTLVGFLMDIIPNSLIGAFTGDQVVNGKLTGPNILQVLFVAVL FGVSLALVGERGKPVLNLLEALIAPVFKLVHILMRAAPIGAFGAIAFTIGKYGVESLVNL AWLVGSFYLTSLLFVLVILGLVSRLCGFSVLKLIRYLKAELLLVLGTSSSESALPSLMEK MEKAGCEKSVVGLVVPTGYSFNLDGTNIYMTLAALFIAQATNTELTLGHQIALLAVAMLS SKGAAGVTGAGFITLAATLAVVPEVPVAGMALILGVDRFMSECRSLTNFIGNAVATVVVS RWENALDRDRLKLVLDGGEPPLLAPVGQPGVAPASLR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | dctA |
Synonyms | dctA; XAC3471; C4-dicarboxylate transport protein |
UniProt ID | Q8PGZ1 |
◆ Recombinant Proteins | ||
RFL34744GF | Recombinant Full Length Glis Glis Atp Synthase Protein 8(Mt-Atp8) Protein, His-Tagged | +Inquiry |
TCYN-1183B | Recombinant Bacillus subtilis TCYN protein, His-tagged | +Inquiry |
ETS1-872H | Recombinant Human ETS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RABL5-4566R | Recombinant Rat RABL5 Protein, His (Fc)-Avi-tagged | +Inquiry |
CALHM3-436R | Recombinant Rhesus Macaque CALHM3 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
ACTC1-166B | Active Native bovine ACTC1 | +Inquiry |
IgG-05T | Native Toxoplasma gondii IgG antigen, RH strain | +Inquiry |
C4-195H | Native Human Complement C4c | +Inquiry |
HDLBP-86H | Native Human Lipoproteins | +Inquiry |
F2-274B | Active Native Bovine α-Thrombin | +Inquiry |
◆ Cell & Tissue Lysates | ||
DGKB-6958HCL | Recombinant Human DGKB 293 Cell Lysate | +Inquiry |
WARS2-369HCL | Recombinant Human WARS2 293 Cell Lysate | +Inquiry |
PCDH8-1295HCL | Recombinant Human PCDH8 cell lysate | +Inquiry |
SMARCA5-1671HCL | Recombinant Human SMARCA5 293 Cell Lysate | +Inquiry |
PGM1-3252HCL | Recombinant Human PGM1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All dctA Products
Required fields are marked with *
My Review for All dctA Products
Required fields are marked with *
0
Inquiry Basket