Recombinant Full Length Woodchuck Hepatitis B Virus Large Envelope Protein(S) Protein, His-Tagged
Cat.No. : | RFL10424WF |
Product Overview : | Recombinant Full Length Woodchuck hepatitis B virus Large envelope protein(S) Protein (P06432) (2-431aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Woodchuck hepatitis B virus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (2-431) |
Form : | Lyophilized powder |
AA Sequence : | GNNIKVTFNPDKIAAWWPAVGTYYTTTYPQNQSVFQPGIYQTTSLINPKNQQELDSVLIN RYKQIDWNTWQGFPVDQKFSLVSRDPPPKPYINQSAQTFEIKPGPIIVPGIRDIPRGLVP PQTPTNRDQGRKPTPPTPPLRDTHPHLTMKNQTFHLQGFVDGLRDLTTTERQHNAYRDPF TTLSPAVPTVSTILSPPSTTGDPALSPEMSPSSLLGLLAGLQVVYFLWTKILTIAQNLDW WCTSLSFPGGIPECTGQNSQFQTCKHLPTSCPPTCNGFRWMYLRRFIIYLLVLLLCLIFL LVLLDWKGLIPVCPLQPTTETTVNCRQCTISAQDMYTPPYCCCLKPTAGNCTCWPIPSSW ALGNYLWEWALARLSWLNLLVPLLQWLGGISLIAWFLLIWMIWFWGPALLSILPPFIPIF VLFFLIWVYI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | S |
Synonyms | S; Large envelope protein; L glycoprotein; L-HBsAg; LHB; Large S protein; Large surface protein; Major surface antigen |
UniProt ID | P06432 |
◆ Recombinant Proteins | ||
NTSR2-2827H | Recombinant Human NTSR2 Protein, His-tagged, OVA Conjugated | +Inquiry |
CCT7-3185C | Recombinant Chicken CCT7 | +Inquiry |
RFL6289HF | Recombinant Full Length Human Olfactory Receptor 5M3(Or5M3) Protein, His-Tagged | +Inquiry |
FAM71A-3791H | Recombinant Human FAM71A Protein, GST-tagged | +Inquiry |
HACL1-1970HFL | Recombinant Full Length Human HACL1 Protein, C-Flag-tagged | +Inquiry |
◆ Native Proteins | ||
Collagen Type III-06H | Native Human Collagen Type III | +Inquiry |
PROZ-5470H | Native Human Protein Z, Vitamin K-Dependent Plasma Glycoprotein | +Inquiry |
CAPN1-186p | Active Native porcine Calpain-1 | +Inquiry |
IgA-249P | Native Pig Immunoglobulin A | +Inquiry |
GC-198H | Native Human GC-Globulin | +Inquiry |
◆ Cell & Tissue Lysates | ||
DUS4L-6787HCL | Recombinant Human DUS4L 293 Cell Lysate | +Inquiry |
NUDT1-3656HCL | Recombinant Human NUDT1 293 Cell Lysate | +Inquiry |
FCGR2B-001HCL | Recombinant Human FCGR2B cell lysate | +Inquiry |
ZNF484-2036HCL | Recombinant Human ZNF484 cell lysate | +Inquiry |
Fetal Kidney-145H | Human Fetal Kidney Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All S Products
Required fields are marked with *
My Review for All S Products
Required fields are marked with *
0
Inquiry Basket