Recombinant Full Length Vibrio Vulnificus Upf0283 Membrane Protein Vv2076(Vv2076) Protein, His-Tagged
Cat.No. : | RFL21649VF |
Product Overview : | Recombinant Full Length Vibrio vulnificus UPF0283 membrane protein VV2076(VV2076) Protein (Q7MJT4) (1-341aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Vibrio Vulnificus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-341) |
Form : | Lyophilized powder |
AA Sequence : | MSDLKPKQVFEETIFSQQDKPELTAQQQFDQQQTFIPTTIEETEPELEDALEQVIRPSGR RKWLAGGLFAAFAGLVGWQAVDSVLSAMQNGDWLTLGWSGFISVLAGLGLGAMGKELWKL RQLRHLFSVQEQGEKLLQSDSVGQGKAFCQQVAKQSGVAEENPAYDRWKNSVNTAHSDAE ILQMYDAMVVTQQDKQATKVISRFATESAALVAISPLAIADMLLVAWRNFKMIDTLSTIY GIELGYASRIRLLRLVLANMAVAGASELVIDAGMDLMSMDLAGKLSARAGQGVGVGILTA RLGLKAMALLRPIPWQAETQVKLSAIRKEIVSKVASITLKP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | VV2076 |
Synonyms | VV2076; UPF0283 membrane protein VV2076 |
UniProt ID | Q7MJT4 |
◆ Recombinant Proteins | ||
BAG5-0533H | Recombinant Human BAG5 Protein (Met1-Asp248), N-His-tagged | +Inquiry |
HBEGFB-5891Z | Recombinant Zebrafish HBEGFB | +Inquiry |
LMO2-8735Z | Recombinant Zebrafish LMO2 | +Inquiry |
BmpA-12B | Recombinant B. burgdorferi BmpA Protein, MBP-tagged | +Inquiry |
VAPB-2875H | Recombinant Human VAPB, His-tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1795A | Active Native Artocarpus integrifolia Jacalin Protein | +Inquiry |
Hemocyanin-30S | Native Shrimp hemocyanin Protein, a substitute for KLH, animal free | +Inquiry |
C1q-04M | Native Mouse C1q Protein | +Inquiry |
ATF-24B | Native Bovine Bovine Apo Transferrin | +Inquiry |
pla-001H | Human Protein S Deficient Plasma | +Inquiry |
◆ Cell & Tissue Lysates | ||
PKIA-3158HCL | Recombinant Human PKIA 293 Cell Lysate | +Inquiry |
BTD-8395HCL | Recombinant Human BTD 293 Cell Lysate | +Inquiry |
WI-38-183H | WI-38 Whole Cell Lysate | +Inquiry |
RPH3AL-2232HCL | Recombinant Human RPH3AL 293 Cell Lysate | +Inquiry |
ZCCHC8-199HCL | Recombinant Human ZCCHC8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All VV2076 Products
Required fields are marked with *
My Review for All VV2076 Products
Required fields are marked with *
0
Inquiry Basket