Recombinant Full Length Vibrio Splendidus Electron Transport Complex Protein Rnfe(Rnfe) Protein, His-Tagged
Cat.No. : | RFL26250VF |
Product Overview : | Recombinant Full Length Vibrio splendidus Electron transport complex protein RnfE(rnfE) Protein (B7VLT3) (1-230aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Vibrio tasmaniensis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-230) |
Form : | Lyophilized powder |
AA Sequence : | MSDHKTLIKNGMWANNPALVQLLGLCPLLAVSSTVTNALGLGIATLLVLVGSNVSVSLVR NHVPKEVRIPVFVMIIASLVTCVQLLMNAYAYGLYLSLGIFIPLIVTNCIIIGRAEAFAS KNEVLPAAQDGFWMGLGMTSVLVVLGAMREIIGNGTLFDGADLLLGDWASVLRIQIFQFD NSFLLALLPPGAFIGVGFLIALKNIIDNQAKSRQPKQEKPVIERARVTNA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | VS_0972 |
Synonyms | rnfE; VS_0972; Ion-translocating oxidoreductase complex subunit E; Rnf electron transport complex subunit E |
UniProt ID | B7VLT3 |
◆ Native Proteins | ||
F2-5402P | Native Porcine Coagulation Factor II (thrombin) | +Inquiry |
CPD A-036H | Active Native Human Pancreatic Carboxypeptidase A | +Inquiry |
Spinal cord-C57M | Mouse Spinal cord whole Lysate, Total Protein | +Inquiry |
PHAL-01P | Active Native Phaseolus vulgaris lectin L Protein | +Inquiry |
MARCKS-12B | Native Bovine MARCKS protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
KDSR-356HCL | Recombinant Human KDSR lysate | +Inquiry |
Kidney-272C | Cynomolgus monkey Kidney Membrane Lysate | +Inquiry |
ELP4-6615HCL | Recombinant Human ELP4 293 Cell Lysate | +Inquiry |
Colon-825M | Mini pig Colon Membrane Lysate, Total Protein | +Inquiry |
Adipose-503D | Dog Adipose Tissue Lysate, Total Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All VS_0972 Products
Required fields are marked with *
My Review for All VS_0972 Products
Required fields are marked with *
0
Inquiry Basket