Recombinant Full Length Vibrio Fischeri Upf0761 Membrane Protein Vfmj11_0098 (Vfmj11_0098) Protein, His-Tagged
Cat.No. : | RFL29663VF |
Product Overview : | Recombinant Full Length Vibrio fischeri UPF0761 membrane protein VFMJ11_0098 (VFMJ11_0098) Protein (B5FFD1) (1-310aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Vibrio fischeri |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-310) |
Form : | Lyophilized powder |
AA Sequence : | MEDKIKHKLRIGWSYLLFLKQRVIHDRLTVSAGYMAYITLLSLVPLITVLLSVLSQFPVF SGAGDTVQAFVIQNFVPAASDAVEASLKEFISNTGKMTAVGSGFLFVASVMLISSIDRSL NYIWRVKKKRRPMYSFSLYWMILTLGPLLVGASLAATSYVTSLKIMDDEIVSSFYRTLLG WLPIILSFSAFVGLYLLVPNKKVRVTHALIGAMSAGCLFEFSKVGFAQYITQFPSYQVIY GALAAVPILFVWVYLCWIIVLIGAEITASLGEFEGWLAGKVSTNILESDIKALTEQQGLI ESDSTDPESK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | VFMJ11_0098 |
Synonyms | VFMJ11_0098; UPF0761 membrane protein VFMJ11_0098 |
UniProt ID | B5FFD1 |
◆ Recombinant Proteins | ||
ALS2CR12-643R | Recombinant Rat ALS2CR12 Protein | +Inquiry |
RFL27706DF | Recombinant Full Length Drosophila Melanogaster Putative Gustatory Receptor 9A(Gr9A) Protein, His-Tagged | +Inquiry |
RGS8-4682R | Recombinant Rat RGS8 Protein, His (Fc)-Avi-tagged | +Inquiry |
OR2F1-3192R | Recombinant Rhesus monkey OR2F1 Protein, His-tagged | +Inquiry |
CYP26C1-3391H | Recombinant Human CYP26C1 Protein, MYC/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
Prothrombin-92M | Native Mouse Prothrombin | +Inquiry |
BGLAP-8519B | Native Bovine BGLAP | +Inquiry |
GG-192M | Native Mouse Gamma Globulin protein | +Inquiry |
HP-4387H | Native Human Haptoglobin | +Inquiry |
C1q-04M | Native Mouse C1q Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MEST-4362HCL | Recombinant Human MEST 293 Cell Lysate | +Inquiry |
Epididymus-117C | Cynomolgus monkey Epididymus Lysate | +Inquiry |
SLC7A11-1698HCL | Recombinant Human SLC7A11 293 Cell Lysate | +Inquiry |
UNKL-496HCL | Recombinant Human UNKL 293 Cell Lysate | +Inquiry |
S100P-2086HCL | Recombinant Human S100P 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All VFMJ11_0098 Products
Required fields are marked with *
My Review for All VFMJ11_0098 Products
Required fields are marked with *
0
Inquiry Basket