Recombinant Full Length Vibrio Cholerae Serotype O1 Vibriobactin-Specific 2,3-Dihydroxybenzoate-Amp Ligase(Vibe) Protein, His-Tagged
Cat.No. : | RFL2105VF |
Product Overview : | Recombinant Full Length Vibrio cholerae serotype O1 Vibriobactin-specific 2,3-dihydroxybenzoate-AMP ligase(vibE) Protein (O07899) (1-543aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Vibrio cholerae serotype O1 |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-543) |
Form : | Lyophilized powder |
AA Sequence : | MTTDFTPWPEALAAQYRQLGYWQDKTLLDYLQQSAERTPNALALVGDNQQWRYQAMLERI EQLAAGFTELGLGCGDNVVLQLGNVAEFYLCFFALLRQGIRPILALPAHRLAEIRYFCQH SQAKAYLIDGAQRPFDYQALAQELLACCPTLQTVIVRGQTRVTDPKFIELASCYSASSCQ ANADPNQIAFFQLSGGTTGTPKLIPRTHNDYAYSVTASVEICRFDQHTRYLCVLPAAHNF PLSSPGALGVFWAGGCVVLSQDASPQHAFKLIEQHKITVTALVPPLALLWMDHAEKSTYD LSSLHFVQVGGAKFSEAAARRLPKALGCQLQQVFGMAEGLVNYTRLDDSAELIATTQGRP ISAHDQLLVVDEQGQPVASGEEGYLLTQGPYTIRGYYRADQHNQRAFNAQGFYITGDKVK LSSEGYVIVTGRAKDQINRGGEKIAAEEVENQLLHHPAVHDAALIAISDEYLGERSCAVI VLKPEQSVNTIQLKRFLHQAGLADYKIPDQIQFIDQLPKTSVGKIDKNALRRRFDTLGLA LMS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | vibE |
Synonyms | vibE; VC_0772; Vibriobactin-specific 2,3-dihydroxybenzoate-AMP ligase; Dihydroxybenzoic acid-activating enzyme |
UniProt ID | O07899 |
◆ Native Proteins | ||
Cyfra-21-1-01H | Native Human MCF-7 Cell Cyfra-21-1 Antigen | +Inquiry |
AsAGP-002B | Native Bovine Asialo-a1-acid glycoprotein Protein | +Inquiry |
vip3A-38B | Native Bacillus thuringiensis vip3A Protein | +Inquiry |
Collagen Type I-10G | Native Goat Collagen Type I Protein | +Inquiry |
TFRC-249H | Native Human Transferrin Receptor | +Inquiry |
◆ Cell & Tissue Lysates | ||
FBXO8-6288HCL | Recombinant Human FBXO8 293 Cell Lysate | +Inquiry |
HYAL1-5324HCL | Recombinant Human HYAL1 293 Cell Lysate | +Inquiry |
IRX4-5156HCL | Recombinant Human IRX4 293 Cell Lysate | +Inquiry |
CD40-1262RCL | Recombinant Rat CD40 cell lysate | +Inquiry |
TTC4-674HCL | Recombinant Human TTC4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All vibE Products
Required fields are marked with *
My Review for All vibE Products
Required fields are marked with *
0
Inquiry Basket