Recombinant Full Length Vibrio Cholerae Serotype O1 Protein Hflk(Hflk) Protein, His-Tagged
Cat.No. : | RFL25059VF |
Product Overview : | Recombinant Full Length Vibrio cholerae serotype O1 Protein HflK(hflK) Protein (Q9KV09) (1-395aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Vibrio cholerae serotype O1 |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-395) |
Form : | Lyophilized powder |
AA Sequence : | MAWNEPGNNNGNNGRDNDPWGNNNRGNKGGRDQGPPDLDEVFNKLSQKLGGKFGGKGGKG PSFSGGGAIGFGVIAAIAVAVWFFTGFYTIGEAERGVVLRLGKYDRIVDPGLNWRPRFID EVTPVNVQAIRSLRASGLMLTKDENVVTVSMDVQYRIADPYKYLYRVTNADDSLRQATDS ALRAVVGDSLMDSILTSGRQQIRQSTQQTLNQVIDSYDMGLMIVDVNFQSARPPEQVKDA FDDAIAAREDEERFIREAEAYKNEILPKATGRAERLKKEAQGYNERTINEALGQVAQFEK LLPEYQAAPKVTRDRLYLDAMEQVYSNTSKVLIDSESSGNLLYLPIDKLAGQDNKTAQPR PNKSSSAYDQIELESQTTETNTDTQSRSTTRQGRY |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | hflK |
Synonyms | hflK; VC_0349; Protein HflK |
UniProt ID | Q9KV09 |
◆ Recombinant Proteins | ||
TIMP2-603H | Recombinant Human TIMP2 Protein, His-tagged | +Inquiry |
MEI1-5467M | Recombinant Mouse MEI1 Protein, His (Fc)-Avi-tagged | +Inquiry |
PIK3CA-7972HF | Active Recombinant Full Length Human PIK3CA Protein, GST-tagged | +Inquiry |
KDR-2895R | Recombinant Rat KDR Protein, His (Fc)-Avi-tagged | +Inquiry |
KDM1A-8027Z | Recombinant Zebrafish KDM1A | +Inquiry |
◆ Native Proteins | ||
Ferritin-024B | Native Bovine Ferritin Protein, holo form | +Inquiry |
IgG-016M | Native Mouse Whole Molecule IgG, Biotin-LC-NHS Conjugated | +Inquiry |
H3N20799-215I | Native H3N2 (A/Panama/2007/99) H3N20799 protein | +Inquiry |
KLK1-29685TH | Native Human KLK1 | +Inquiry |
HA-007R | Native Rooster comb Hyaluronic acid sodium salt | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL1RN-2912HCL | Recombinant Human IL1RN cell lysate | +Inquiry |
PATL1-473HCL | Recombinant Human PATL1 lysate | +Inquiry |
ARF4-8758HCL | Recombinant Human ARF4 293 Cell Lysate | +Inquiry |
OPA3-3575HCL | Recombinant Human OPA3 293 Cell Lysate | +Inquiry |
FCGRT & B2M-1545MCL | Recombinant Mouse FCGRT & B2M cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All hflK Products
Required fields are marked with *
My Review for All hflK Products
Required fields are marked with *
0
Inquiry Basket