Recombinant Full Length Vibrio Cholerae Serotype O1 Hemolysin Secretion Protein(Hlyb) Protein, His-Tagged
Cat.No. : | RFL2810VF |
Product Overview : | Recombinant Full Length Vibrio cholerae serotype O1 Hemolysin secretion protein(hlyB) Protein (P15492) (18-548aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Vibrio cholerae serotype O1 |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (18-548) |
Form : | Lyophilized powder |
AA Sequence : | IPAIALLFVAFTSLNTMSVMQAQSNSLYANTAAPMRAMAEATSRIPRMRVGIDMMLLQET ALKDAKGVLKRVEEARTEDIPEMRQAMQVAVDSQVNPELKEQARKLQARFEQMVREELEP MLQAFANNDMTTAQNIYRDKYAPTYGEMRKQANQILDTLLQQAEQQNHASVESFEAGRTK QMVIIAAGLIISFITSLVIITNLRSRVAYLKDRMSSAAANLSLRTRLELDGNDELCDIGK SFNAFIDKVHHSIEEVAENSKELATMASSVSQRAHMTQSNCASQRDRTVQVATAIHELGA TVSEIASNAAMAADVAKQATLHSGEGKKVVGEVQNRIQTLVNELDNATQVVSSLATQING ISSTLDTIRSISEQTNLLALNAAIEAARAGEQGRGFAVVADEVRTLASRSAASTEEIQQV INRLQTESTRAVEAMEKGRSQSDVVVEFSAKANQSLTEINSQIDQINDQNIQVATATEEQ STVVEDINRNVEDINQLTTETSHVADELSRASASLQRLSSQLDKLVGSFEL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | hlyB |
Synonyms | hlyB; VC_A0220; Methyl-accepting chemotaxis protein HlyB |
UniProt ID | P15492 |
◆ Native Proteins | ||
LDL-393H | Native Human Low Density Lipoprotein | +Inquiry |
LDH5-24H | Active Native Human Lactate Dehydrogenase 5 | +Inquiry |
IgG1-227H | Native Human Immunoglobulin G1 (IgG1) | +Inquiry |
HSV2Ag-355H | Active Native Herpes Simplex Virus 2 Protein | +Inquiry |
BOD-38 | Active Native Bilirubin oxidase | +Inquiry |
◆ Cell & Tissue Lysates | ||
PSMB5-2771HCL | Recombinant Human PSMB5 293 Cell Lysate | +Inquiry |
ACTL9-1098HCL | Recombinant Human ACTL9 cell lysate | +Inquiry |
GPRASP2-747HCL | Recombinant Human GPRASP2 cell lysate | +Inquiry |
PAK3-517HCL | Recombinant Human PAK3 cell lysate | +Inquiry |
PDE4C-3351HCL | Recombinant Human PDE4C 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All hlyB Products
Required fields are marked with *
My Review for All hlyB Products
Required fields are marked with *
0
Inquiry Basket