Recombinant Full Length Venezuelan Equine Encephalitis Virus Structural Polyprotein Protein, His-Tagged
Cat.No. : | RFL36148VF |
Product Overview : | Recombinant Full Length Venezuelan equine encephalitis virus Structural polyprotein Protein (P36332) (814-1255aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | VEEV |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (814-1255) |
Form : | Lyophilized powder |
AA Sequence : | YEHATTMPSQAGISYNTIVNRAGYAPLPISITPTKIKLIPTVNLEYVTCHYKTGMDSPAI KCCGSQECTPTNRPDEQCKVFTGVYPFMWGGAYCFCDTENTQVSKAYVMKSDDCLADHAE AYKAHTASVQAFLNITVGEHSIVTTVYVNGETPVNFNGVKLTAGPLSTAWTPFDRKIVQY AGEIYNYDFPEYGAGQPGAFGDIQSRTVSSSDLYANTNLVLQRPKAGAIHVPYTQAPSGF EQWKKDKAPSLKFTAPFGCEIYTNPIRAENCAVGSIPLAFDIPDALFTRVSETPTLSAAE CTLNECVYSSDFGGIATVKYSASKSGKCAVHVPSGTATLKEAAVELTEQGSATIHFSTAN IHPEFRLQICTSYVTCKGDCHPPKDHIVTHPQYHAQTFTAAVSKTAWTWLTSLLGGSAVI IIIGLVLATIVAMYVLTNQKHN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Venezuelan equine encephalitis virus Structural polyprotein |
Synonyms | Structural polyprotein; p130 |
UniProt ID | P36332 |
◆ Recombinant Proteins | ||
A44R-09M | Recombinant Monkeypox virus/MPXV A44R Protein, GST/His-tagged | +Inquiry |
RFL33647DF | Recombinant Full Length Dehalococcoides Sp. Atp Synthase Subunit C(Atpe) Protein, His-Tagged | +Inquiry |
EQTN-2130R | Recombinant Rat EQTN Protein | +Inquiry |
WNT5A-118H | Active Recombinant Human WNT5A Protein | +Inquiry |
STAC3-16088M | Recombinant Mouse STAC3 Protein | +Inquiry |
◆ Native Proteins | ||
Lectin-1727W | Native Wheat Germ Lectin, Biotin conjugated | +Inquiry |
Mucin-312 | Native Porcine Mucin Type II protein | +Inquiry |
TIMP1-30840TH | Native Human TIMP1 | +Inquiry |
Hemoglobin F-034H | Native Human Hemoglobin F Protein | +Inquiry |
F13A1-28806TH | Native Human F13A1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
FCN1-2748HCL | Recombinant Human FCN1 cell lysate | +Inquiry |
TCP11-1754HCL | Recombinant Human TCP11 cell lysate | +Inquiry |
CYTH4-7093HCL | Recombinant Human CYTH4 293 Cell Lysate | +Inquiry |
RPN2-2182HCL | Recombinant Human RPN2 293 Cell Lysate | +Inquiry |
HPX-2279MCL | Recombinant Mouse HPX cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Venezuelan equine encephalitis virus Structural polyprotein Products
Required fields are marked with *
My Review for All Venezuelan equine encephalitis virus Structural polyprotein Products
Required fields are marked with *
0
Inquiry Basket