Recombinant Full Length Variola Virus Late Protein H7 (H7R) Protein, His-Tagged
Cat.No. : | RFL18976VF |
Product Overview : | Recombinant Full Length Variola virus Late protein H7 (H7R) Protein (P33063) (1-146aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | VARV |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-146) |
Form : | Lyophilized powder |
AA Sequence : | MEMDKRMKSLAMTAFFGELTTLDIMALIMSIFKRHPNNTIFSVDKDGQFMIDFEYDTYKA SQYLDLPLTPISGDECKTHASSIAKQLACVDIIKEDISEYIKTTPRLKRFIKKYRNRSDT RISQDTEKLKIALAKGIDYEYIKDAC |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | H7R |
UniProt ID | P33063 |
◆ Recombinant Proteins | ||
DNAJC8-1126R | Recombinant Rhesus Macaque DNAJC8 Protein, His (Fc)-Avi-tagged | +Inquiry |
SLC25A20-3754H | Recombinant Human SLC25A20 protein, His-tagged | +Inquiry |
RFL9850EF | Recombinant Full Length Escherichia Coli O9:H4 Zinc Transporter Zupt(Zupt) Protein, His-Tagged | +Inquiry |
Oas1a-7996R | Recombinant Rat Oas1a protein, His & T7-tagged | +Inquiry |
ZBTB7A-6246C | Recombinant Chicken ZBTB7A | +Inquiry |
◆ Native Proteins | ||
LTF-229B | Native Bovine Lactoferrin | +Inquiry |
MMP9-41H | Native Human MMP-9/TIMP-1 Complex | +Inquiry |
FGA-80H | Active Native Human Fibrinogen (plasminogen depleted) | +Inquiry |
Collagen Type I-61H | Native Human Collagen Type I/III | +Inquiry |
APOA1-23D | Native Dog Apolipoprotein A1 (APOA1) Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
C20orf185-8122HCL | Recombinant Human C20orf185 293 Cell Lysate | +Inquiry |
HTR3E-5332HCL | Recombinant Human HTR3E 293 Cell Lysate | +Inquiry |
R3HDM2-2135HCL | Recombinant Human R3HDM2 cell lysate | +Inquiry |
IGFBP5-764CCL | Recombinant Cynomolgus IGFBP5 cell lysate | +Inquiry |
CC2D1A-7799HCL | Recombinant Human CC2D1A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All H7R Products
Required fields are marked with *
My Review for All H7R Products
Required fields are marked with *
0
Inquiry Basket