Recombinant Full Length Varicella-Zoster Virus Alpha Trans-Inducing Factor 74 Kda Protein (Orf12) Protein, His-Tagged
Cat.No. : | RFL13248VF |
Product Overview : | Recombinant Full Length Varicella-zoster virus Alpha trans-inducing factor 74 kDa protein (ORF12) Protein (P09264) (1-661aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | VZV |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-661) |
Form : | Lyophilized powder |
AA Sequence : | MFSRFARSFSSDDRTRKSYDGSYQSFNAGERDLPTPTRDWCSISQRITSERVRDGCLIPT PGEALETAVKALSEKTDSLTSPVLQSTERHSVLLGLHHNNVPESLVVSCMSNDVHDGFMQ RYMETIQRCLDDLKLSGDGLWWVYENTYWQYLKYTTGAEVPVTSEKVNKKSKSTVLLFSS VVANKPISRHPFKSKVINSDYRGICQELREALGAVQKYMYFMRPDDPTNPSPDTRIRVQE IAAYTATGYGWMLWFLDVVDARVCRHLKLQFRRIRGPRASVIPDDLLRRHLKTGPAVSAG TGVAFILAATTASALTALLRISVLWRKEEWRDGLNGTAAAIVAAVELITLLHHHFQYLIN MMLIGYACWGDGGLNDPYILKALRAQGRFLYFAGQLVRTMSTHSWVVLETSTHMWFSRAV AQSILAHGGKPTKYYAQVLAASKRYTPLHLRRISEPSSVSDQPYIRFNRLGSPIGTGIGN LECVCLTGNYLSDDVNASSHVINTEAPLNSIAPDTNRQRTSRVLVRPDTGLDVTVRKNHC LDIGHTDGSPVDPTYPDHYTRIKAEYEGPVRDESNTMFDQRSDLRHIETQASLNDHVYEN IPPKEVGFNSSSDLDVDSLNGYTSGDMHTDDDLSPDFIPNDVPVRCKTTVTFRKNTPKSH H |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ORF12 |
Synonyms | ORF12; Tegument protein UL46 homolog; Tegument protein VP11/12 homolog |
UniProt ID | P09264 |
◆ Recombinant Proteins | ||
RFL22813HF | Recombinant Full Length Human C5A Anaphylatoxin Chemotactic Receptor 2(C5Ar2) Protein, His-Tagged | +Inquiry |
SUCNR1-16210M | Recombinant Mouse SUCNR1 Protein | +Inquiry |
ESRRA-12204Z | Recombinant Zebrafish ESRRA | +Inquiry |
RFL23660PF | Recombinant Full Length Pseudomonas Aeruginosa Monofunctional Biosynthetic Peptidoglycan Transglycosylase(Mtga) Protein, His-Tagged | +Inquiry |
SLC2A9-2547H | Recombinant Human SLC2A9 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Alb-113R | Native Rat Serum Albumin | +Inquiry |
SERPINF2-27292TH | Native Human SERPINF2 | +Inquiry |
LDL-247H | Native Human Lipoproteins, Very Low Density | +Inquiry |
TF-5341H | Native Human Transferring | +Inquiry |
FGG -44D | Native Canine Fibrinogen, FITC Labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
SNIP1-1628HCL | Recombinant Human SNIP1 293 Cell Lysate | +Inquiry |
ZNF580-44HCL | Recombinant Human ZNF580 293 Cell Lysate | +Inquiry |
GUCA1A-002HCL | Recombinant Human GUCA1A cell lysate | +Inquiry |
IFNA13-1154CCL | Recombinant Cynomolgus IFNA13 cell lysate | +Inquiry |
Liver-073MCL | Adult Mouse Liver Whole Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ORF12 Products
Required fields are marked with *
My Review for All ORF12 Products
Required fields are marked with *
0
Inquiry Basket