Recombinant Full Length Vanderwaltozyma Polyspora Probable Metalloreductase Aim14(Aim14) Protein, His-Tagged
Cat.No. : | RFL1321VF |
Product Overview : | Recombinant Full Length Vanderwaltozyma polyspora Probable metalloreductase AIM14(AIM14) Protein (A7TQE6) (1-519aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Vanderwaltozyma polyspora |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-519) |
Form : | Lyophilized powder |
AA Sequence : | MDELVKRHGSTHFANINYGYYILFLSIIYIILLFCLRNYAKITTRSTRFFKKLYSLNPFI HLSILLIAIFIPFYQPHLNKLTVYYKRLGRLSYTLIPLNLFLTLKPNWFLPSQCTYTDFI PIHKWLSRFITFIAILHSILFLSHWSSSSDENVSIAIKLQNPKNVLGLIMLIPSLLLICL SIGPFRRFSYTSFYIIHNISNVMLIFLTPIHARPGVAIPYLIINSILLLAIAFNKIFFIK KSELLAKETLPNYDNNSSLVTIRLPRSALPETFTPACHIRISPYQFFNPLYWLLPSHPYT VVSLPSDDSVDLVLTENIKKFAFRLHMERSYTIINQFNPSVPIACLNSSKRVCIVCGGTG ISFGLPLYRYFSEIIERNQRSIEYLRLIWMVKDKSQIKILEKLNSLKYDLEDKNFTSNFH VFITQYSSKSSGIEDSSGSGYELEDLTPEDPSSIGPYIFGSVNFGRRIEWTTDLSTFVEH DNDIDNTWMLACGPSTLVESANKYADKSGVRFASEIYTL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | AIM14 |
Synonyms | AIM14; Kpol_467p2; Probable metalloreductase AIM14 |
UniProt ID | A7TQE6 |
◆ Recombinant Proteins | ||
MERTK-3650R | Recombinant Rat MERTK Protein | +Inquiry |
Ifna1-638M | Recombinant Mouse Ifna1 protein, His & GST-tagged | +Inquiry |
IMPAD1-3059R | Recombinant Rat IMPAD1 Protein | +Inquiry |
NCAPG2-2772R | Recombinant Rhesus Macaque NCAPG2 Protein, His (Fc)-Avi-tagged | +Inquiry |
ABCA7-184M | Recombinant Mouse ABCA7 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
IgG-7438M | Native Mouse IgG Fc Protein, Biotin conjugated | +Inquiry |
GLDH-213B | Active Native Bovine Glutamate Dehydrogenase | +Inquiry |
Pla2-85A | Active Native Apis mellifera Phospholipase A2 | +Inquiry |
ACOD-35 | Active Native acyl-CoA oxidase | +Inquiry |
CHC-001C | Native Clostridium Histolyticum Collagenase, Tag Free | +Inquiry |
◆ Cell & Tissue Lysates | ||
RPAP2-2238HCL | Recombinant Human RPAP2 293 Cell Lysate | +Inquiry |
CYP21A2-7123HCL | Recombinant Human CYP21A2 293 Cell Lysate | +Inquiry |
ADCY3-9021HCL | Recombinant Human ADCY3 293 Cell Lysate | +Inquiry |
HL60-037WCY | Human Acute Promyelocytic Leukemia HL60 Whole Cell Lysate | +Inquiry |
RNH1-2269HCL | Recombinant Human RNH1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AIM14 Products
Required fields are marked with *
My Review for All AIM14 Products
Required fields are marked with *
0
Inquiry Basket