Recombinant Full Length Vanderwaltozyma Polyspora Mitochondrial Distribution And Morphology Protein 32(Mdm32) Protein, His-Tagged
Cat.No. : | RFL30683VF |
Product Overview : | Recombinant Full Length Vanderwaltozyma polyspora Mitochondrial distribution and morphology protein 32(MDM32) Protein (A7THL9) (18-676aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Vanderwaltozyma polyspora |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (18-676) |
Form : | Lyophilized powder |
AA Sequence : | IYLGSQCSNSVSRLTVGSTFRLVRMKSWGTSKFHTNGSPVLNEIKKISKSNGITIINPLV NKVTTNNVSTSSNGKAAVAAATAATAVSLGSTGQDDALSRNTDFLHIQNILLQKNQDRMN KQKLLSEATNFYERFKINTKWLLIRGNRPFSADEIGTLFSWIILSQILWIILGTTTFVSI LLIIFNTVFAKEMVGNVVGKLLNIFLDGIDVKFQDALVPEWRKGCIRFNNVQLRTHPLQA SEPENINDYNELVNNMIEFDLKLHQIELSLSLKKWLLGNGLIQDLTIMGMRGNITVTPVS LENKIDDNQRVNLIDWFSNPYYHLGNVKVTDSSIILHDNQLSKDFKVSIYNLDMPQLRFQ WIINDFLSSNVVDGSINHSLFNIHKRQHKLAYIKDLENDLSDWKRITRIRLDSIDVKKLG LNNSNAFNWMDDGQLDIIADVMLPNEQENEPDFDFTRNKKEHMSKSNNKYVVLDLKFRFK DLKAIFPDRAPRLSNGEEILSLDELKQIILFINRKYDLYHSYANSSYKNTLWDAPNIAIN KAKSFPVTTVFQSKKDFSNEDSDEEDRKLKKQIIRFHDDISTPNNELVLSCKVVKNINEL KNMVLFWETGIYDSLSMELYIDLMKMVEEWEYKKKTNWMTDWGSSVASQLIIVGFGAMV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MDM32 |
Synonyms | MDM32; Kpol_543p14; Mitochondrial distribution and morphology protein 32 |
UniProt ID | A7THL9 |
◆ Native Proteins | ||
HPIV3ag-275V | Active Native Parainfluenza Virus type 3(strain III v 2932) Protein | +Inquiry |
IgG2-229H | Native Human Immunoglobulin G2 (IgG2) | +Inquiry |
MYS-01R | Active Native Rabbit Heavy Meromyosin Protein | +Inquiry |
COL3A1-18B | Native Bovine COL3A1 Protein | +Inquiry |
IgG-152R | Native Rat IgG Fab fragment | +Inquiry |
◆ Cell & Tissue Lysates | ||
PAPD7-3442HCL | Recombinant Human PAPD7 293 Cell Lysate | +Inquiry |
KIAA1586-4961HCL | Recombinant Human KIAA1586 293 Cell Lysate | +Inquiry |
Pericardium Lupus-227H | Human Heart: Pericardium Lupus Lysate | +Inquiry |
AP3S2-8807HCL | Recombinant Human AP3S2 293 Cell Lysate | +Inquiry |
BNIP2-8424HCL | Recombinant Human BNIP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MDM32 Products
Required fields are marked with *
My Review for All MDM32 Products
Required fields are marked with *
0
Inquiry Basket