Recombinant Full Length Vaccinia Virus Virion Membrane Protein A16 (A16L) Protein, His-Tagged
Cat.No. : | RFL6613VF |
Product Overview : | Recombinant Full Length Vaccinia virus Virion membrane protein A16 (A16L) Protein (P20993) (2-378aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | VACV |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (2-378) |
Form : | Lyophilized powder |
AA Sequence : | GAAVTLNRIKIAPGIADIRDKYMELGFNYPEYNRAVKFAEESYTYYYETSPGEIKPKFCL IDGMSIDHCSSFIVPEFAKQYVLIHGEPCSSFKFRPGSLIYYQNEVTPEYIKDLKHATDY IASGQRCHFIKKDYLLGDSDSVAKCCSKTNTKHCPKIFNNNYKTEHCDDFMTGFCRNDPG NPNCLEWLRAKRKPAMSTYSDICSKHMDARYCSEFIRIIRPDYFTFGDTALYVFCNDHKG NRNCWCANYPKSNSGDKYLGPRVCWLHECTDESRDRKWLYYNQDVQRTRCKYVGCTINVN SLALKNSQAELTSNCTRTTSAVGDVHHPGEPVVKDKIKLPTWLGAAITLVVISVIFYFIS IYSRPKIKTNDINVRRR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | A16L |
Synonyms | A16L; Virion membrane protein A16 |
UniProt ID | P20993 |
◆ Recombinant Proteins | ||
B4galt4-06HCL | Recombinant Mouse B4galt4 overexpression lysate | +Inquiry |
STAT2-2997H | Recombinant Human STAT2, GST-tagged | +Inquiry |
Pdia2-4763M | Recombinant Mouse Pdia2 Protein, Myc/DDK-tagged | +Inquiry |
RETNLB-5004H | Recombinant Human Resistin Like Beta | +Inquiry |
DDX19A-11892H | Recombinant Human DDX19A, GST-tagged | +Inquiry |
◆ Native Proteins | ||
ASOM-37 | Active Native L-ascorbate oxidase | +Inquiry |
Trf-4782M | Native Mouse Transferrin | +Inquiry |
LDH-17H | Active Native Human Lactate Dehydrogenase | +Inquiry |
CAT-1847B | Active Native Bovine, Catalase | +Inquiry |
CDA002 | Active Native Human MUC16 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PTPLAD1-1435HCL | Recombinant Human PTPLAD1 cell lysate | +Inquiry |
LOC391763-1015HCL | Recombinant Human LOC391763 cell lysate | +Inquiry |
HS3ST3A1-817HCL | Recombinant Human HS3ST3A1 cell lysate | +Inquiry |
CD22-001MCL | Recombinant Mouse CD22 cell lysate | +Inquiry |
EIF2S2-6665HCL | Recombinant Human EIF2S2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All A16L Products
Required fields are marked with *
My Review for All A16L Products
Required fields are marked with *
0
Inquiry Basket