Recombinant Full Length Vaccinia Virus Myristoylated Protein G9(Tg10R) Protein, His-Tagged
Cat.No. : | RFL22972VF |
Product Overview : | Recombinant Full Length Vaccinia virus Myristoylated protein G9(TG10R) Protein (Q9JFC1) (2-340aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | VACV |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (2-340) |
Form : | Lyophilized powder |
AA Sequence : | GGGVSVELPKRDPPPGVPTDEMLLNVDKMHDVIAPAKLLEYVHIGPLAKDKEDKVKKRYP EFRLVNTGPGGLSALLRQSYNGTAPNCCRTFNRTHYWKKDGKISDKYEEGAVLESCWPDV HDTGKCDVDLFDWCQGDTFDRNICHQWIGSAFNRSNRTVEGQQSLINLYNKMQTLCSKDA SVPICESFLHHLRAHNTEDSKEMIDYILRQQSADFKQKYMRCSYPTRDKLEESLKYAEPR ECWDPECSNANVNFLLTRNYNNLGLCNIVRCNTSVNNLQMDKTSSLRLSCGLSNSDKFST VPVNRAKVVQHNIKHSFDLKLHLISLLSLLVIWILIVAI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TG10R |
Synonyms | TG10R; Myristoylated protein G9 |
UniProt ID | Q9JFC1 |
◆ Recombinant Proteins | ||
RFL14917LF | Recombinant Full Length Leuconostoc Mesenteroides Subsp. Mesenteroides Protease Htpx Homolog(Htpx) Protein, His-Tagged | +Inquiry |
TAOK3-8985M | Recombinant Mouse TAOK3 Protein, His (Fc)-Avi-tagged | +Inquiry |
COMMD6-1683H | Recombinant Human COMMD6 Protein, GST-tagged | +Inquiry |
MAGEE1-3539R | Recombinant Rat MAGEE1 Protein | +Inquiry |
LC3-518H | Recombinant Human LC3, His-tagged | +Inquiry |
◆ Native Proteins | ||
FSH-930B | Active Native Bovine FSH Protein | +Inquiry |
CGA-8356H | Native Human CGA | +Inquiry |
PRSS1-30745TH | Active Native Human PRSS1 | +Inquiry |
Compound E-12 | Compound E, Antibotics Free | +Inquiry |
OX-LDL-985H | Native Human Lipoproteins, Oxidized LDL protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TAF2-1269HCL | Recombinant Human TAF2 293 Cell Lysate | +Inquiry |
FAM175B-6404HCL | Recombinant Human FAM175B 293 Cell Lysate | +Inquiry |
DNMBP-501HCL | Recombinant Human DNMBP cell lysate | +Inquiry |
CACNG2-7901HCL | Recombinant Human CACNG2 293 Cell Lysate | +Inquiry |
IL11RA-2389HCL | Recombinant Human IL11RA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TG10R Products
Required fields are marked with *
My Review for All TG10R Products
Required fields are marked with *
0
Inquiry Basket