Recombinant Full Length V-Type Sodium Atpase Subunit I(Ntpi) Protein, His-Tagged
Cat.No. : | RFL25229EF |
Product Overview : | Recombinant Full Length V-type sodium ATPase subunit I(ntpI) Protein (P43439) (1-664aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Enterococcus hirae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-664) |
Form : | Lyophilized powder |
AA Sequence : | MAVTKMEKVTLISDKKNREILLQAVQGLHAVEIRDLFQESENNQWVETFFPEPEMIDKDK ELAKLSYKLTDIRTAIQFIEHHGEKSQKKQHLKRRELSLDTLEKNYSEEAFSKKLEEVLL LKEQWEQLVDERQQLEDQENWLLNWQNLDLAPKAFDSQMTKLVIGTVNAKNAESFKAEVA EINEAYLEEINSSPTTTYFAYIVLRADESRMEEIASRYGFVKEDYLYEGTPQQQLVAAKQ SLQEIKDQQKKLSSAIGACSGYIKDFEWTEEIFLARSEREAIKDRIIHTPYLILIQGWVD HEEKQELIHMLQNILASEEVYLTFDEPTDNEIAEEVPTKLKNHPIVAPFEMLTEMYSLPK YEEVDPTPWMMPFYLVFFGMMVADIGYGLLMFLGAFLLQKLVVLPRGMQRFAKFFEILAI PSIIWGFIYSSFFGAALPKEIFGIHLPFPILSTTDDVNTILILSVIFGLIQILVGLFIAA KEHIKRKAYVDAVNDGFAWQWILLGIILILLGTMTLKNNAFVYLGGALAVLSAVCILIIP VFQSSSKAKGIAKGAYNLYGLTGYIGDLVSYTRLMALGISGGSIAAAFNMLVAFMPPAAR FSVGILLIIVLQALNMFLTLLSAYVHGARLQYVEFFGKFYTGGGRSFKPLKTVEKYVNIN HKKK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ntpI |
Synonyms | ntpI; ntpM; EHR_08235; V-type sodium ATPase subunit I; Na(+-translocating ATPase subunit I; V-type sodium pump subunit I |
UniProt ID | P43439 |
◆ Recombinant Proteins | ||
Chl1-1646M | Recombinant Mouse Chl1 Protein, His (Fc)-Avi-tagged | +Inquiry |
FCGR3-1457M | Active Recombinant Mouse FCGR3 protein, His-tagged | +Inquiry |
RFL22598CF | Recombinant Full Length Chlorobium Chlorochromatii Undecaprenyl-Diphosphatase(Uppp) Protein, His-Tagged | +Inquiry |
FAM72A-1920R | Recombinant Rat FAM72A Protein, His (Fc)-Avi-tagged | +Inquiry |
Cd40lg-545RAF488 | Recombinant Rat Cd40lg Protein, Fc-tagged, Alexa Fluor 488 conjugated | +Inquiry |
◆ Native Proteins | ||
MPO-8220H | Native Human Neutrophil Myeloperoxidase | +Inquiry |
LOC102577615-62P | Native potato LOC102577615 Protein | +Inquiry |
IgG-019R | Native Rat Whole Molecule IgG, Biotin-LC-NHS Conjugated | +Inquiry |
ALB-112P | Native Pigeon Serum Albumin | +Inquiry |
LH-9389B | Active Native Bovine LH Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
GPX1-5763HCL | Recombinant Human GPX1 293 Cell Lysate | +Inquiry |
TMEM81-929HCL | Recombinant Human TMEM81 293 Cell Lysate | +Inquiry |
PRAP1-001HCL | Recombinant Human PRAP1 cell lysate | +Inquiry |
HA-1667HCL | Recombinant H4N8 HA cell lysate | +Inquiry |
EPHA4-001HCL | Recombinant Human EPHA4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All ntpI Products
Required fields are marked with *
My Review for All ntpI Products
Required fields are marked with *
0
Inquiry Basket