Recombinant Full Length Upf0397 Protein Vv2_1534(Vv2_1534) Protein, His-Tagged
Cat.No. : | RFL976VF |
Product Overview : | Recombinant Full Length UPF0397 protein VV2_1534(VV2_1534) Protein (Q8D3Z8) (1-182aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Vibrio Vulnificus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-182) |
Form : | Lyophilized powder |
AA Sequence : | MNLSAKTVVVIAIGAALYGIGGLPMFGIPVFANTTLKPAMAVLALFSVLFGPLVGFLVGF IGHWVTDLFAGWGVWLTWVLGSGIVGLIIGLFPSLTRNRLEKGEFNLKDFSLFVVLALLG NVFGYGCSAFLDTILYAEPFTKVFTQLTIIASGNTVLIAIVGYFILKSVAKRNKQSRNLT EA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | VV2_1534 |
Synonyms | VV2_1534; UPF0397 protein VV2_1534 |
UniProt ID | Q8D3Z8 |
◆ Native Proteins | ||
CA6-804H | Native Human CA6 | +Inquiry |
IgG-126R | Native Rat Immunoglobulin G | +Inquiry |
Serpinc1-5485M | Native Mouse Serpin (or cysteine) Peptidase Inhibitor, Clade C (antithrombin), Member 1 | +Inquiry |
CST3-4309H | Native Human CST3 Protein | +Inquiry |
Chylomicrons-192H | Native Human Chylomicrons | +Inquiry |
◆ Cell & Tissue Lysates | ||
BOLL-8419HCL | Recombinant Human BOLL 293 Cell Lysate | +Inquiry |
GBP1-1686HCL | Recombinant Human GBP1 cell lysate | +Inquiry |
ASF1B-001HCL | Recombinant Human ASF1B cell lysate | +Inquiry |
TNS1-1804HCL | Recombinant Human TNS1 cell lysate | +Inquiry |
SCN3B-1589HCL | Recombinant Human SCN3B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All VV2_1534 Products
Required fields are marked with *
My Review for All VV2_1534 Products
Required fields are marked with *
0
Inquiry Basket