Recombinant Full Length Upf0397 Protein Gbs1681(Gbs1681) Protein, His-Tagged
Cat.No. : | RFL7706SF |
Product Overview : | Recombinant Full Length UPF0397 protein gbs1681(gbs1681) Protein (Q8E3S5) (1-182aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Streptococcus agalactiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-182) |
Form : | Lyophilized powder |
AA Sequence : | MNTNTIKKVVATGIGAALFIIIGMLVNIPTPIPNTNIQLQYAVLALFAVIYGPGVGFFTG FIGHALKDSIQYGSPWWTWVLVSGLLGLMIGFFAKKLAIQLSGMTKKDLLLFNVVQVIAN LIGWSVVAPYGDIFFYSEPASKVFAQGFLSSLVNSITIGVGGTLLLLAYAKSRPQKGSLS KD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | gbs1681 |
Synonyms | gbs1681; UPF0397 protein gbs1681 |
UniProt ID | Q8E3S5 |
◆ Native Proteins | ||
CALM3-74B | Native Bovine Calmodulin | +Inquiry |
Glycogen-016B | Native bovine liver Glycogen | +Inquiry |
HBA2-27786TH | Native Human HBA2 | +Inquiry |
BIAP-76B | Native Bovine Intestinal Alkaline Phosphatase | +Inquiry |
A2m-367M | Native Mouse Alpha-2-Macroglobulin | +Inquiry |
◆ Cell & Tissue Lysates | ||
C5orf51-252HCL | Recombinant Human C5orf51 cell lysate | +Inquiry |
NKX2-3812HCL | Recombinant Human NKX2 293 Cell Lysate | +Inquiry |
CLDN11-1288HCL | Recombinant Human CLDN11 cell lysate | +Inquiry |
NKRF-3815HCL | Recombinant Human NKRF 293 Cell Lysate | +Inquiry |
UEVLD-523HCL | Recombinant Human UEVLD 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All gbs1681 Products
Required fields are marked with *
My Review for All gbs1681 Products
Required fields are marked with *
0
Inquiry Basket