Recombinant Full Length Upf0392 Protein F13G3.3(F13G3.3) Protein, His-Tagged
Cat.No. : | RFL27502CF |
Product Overview : | Recombinant Full Length UPF0392 protein F13G3.3(F13G3.3) Protein (Q19417) (1-501aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Caenorhabditis elegans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-501) |
Form : | Lyophilized powder |
AA Sequence : | MLPRIIPSVLSVVLLFSFLFFVTAVLLQFIRIDSPDLENEEVFHSAPYDIFIYSAFYYNK SKSLGDSSMVILMTADFEVLEKVKNLELLGINDTSRAMTSAELERVTIHDACKWIAMTAT AKIVLNPSLLLVSLGGNHAPIPFEVVSSEPKPVVMCISPLFAAENWHNLLVSLHVYKIFG AHMHLYIRSIVSPMLEILRVYEQEGYATLKPWNRINLLNRDEQDFNPNLNVEFRSQAAAQ TDCLLRYKESSEFVAFVDLDDLIIPRVADNYASEFRYLASEHPTVAYFTYSKENTRIKAY KRANVFSIEHVLRNIKHEQQTETGKMIAIPSKINNTWIHWPQKNLKKLAVKPEFNSITHL KHIELLDGLKSKNEEEPKYNPSTGLDNDKPLISNKNIKMIEKDFNRMSWKSSVRRHLRNL PINMTYSKLISDCYKQSYYAFHSANENHGMLCPGPERCDISNHKTRCWISVGEYHSTRDG KLINVHFAENADFALNDGCQV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | F13G3.3 |
Synonyms | F13G3.3; Glycosyltransferase family 92 protein F13G3.3 |
UniProt ID | Q19417 |
◆ Recombinant Proteins | ||
CDC2-0906H | Recombinant Human CDC2 protein(Met1-Met297), GST-tagged | +Inquiry |
DGKA-2349M | Recombinant Mouse DGKA Protein, His (Fc)-Avi-tagged | +Inquiry |
groL-1215H | Recombinant Helicobacter pylori groL protein, His&Myc-tagged | +Inquiry |
SPO0F-0027B | Recombinant Bacillus subtilis SPO0F protein, His-tagged | +Inquiry |
BSX-2514M | Recombinant Mouse BSX Protein | +Inquiry |
◆ Native Proteins | ||
HP-193S | Native Swine Haptoglobin | +Inquiry |
CGB-1850H | Native Human Chorionic Gonadotropin, Beta Polypeptide | +Inquiry |
APOA2-8036H | Native Human ApoLipoprotein APOA2 | +Inquiry |
C1Q-20H | Active Native Human C1q Protein | +Inquiry |
IgG-125G | Native Goat Immunoglobulin G | +Inquiry |
◆ Cell & Tissue Lysates | ||
CNTFR-598RCL | Recombinant Rat CNTFR cell lysate | +Inquiry |
DHX30-6932HCL | Recombinant Human DHX30 293 Cell Lysate | +Inquiry |
SLC39A5-1718HCL | Recombinant Human SLC39A5 293 Cell Lysate | +Inquiry |
KCNMB3-5025HCL | Recombinant Human KCNMB3 293 Cell Lysate | +Inquiry |
TAF2-1269HCL | Recombinant Human TAF2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All F13G3.3 Products
Required fields are marked with *
My Review for All F13G3.3 Products
Required fields are marked with *
0
Inquiry Basket