Recombinant Full Length Upf0359 Membrane Protein D1046.5(D1046.5) Protein, His-Tagged
Cat.No. : | RFL27933CF |
Product Overview : | Recombinant Full Length UPF0359 membrane protein D1046.5(D1046.5) Protein (Q18936) (1-458aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Caenorhabditis elegans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-458) |
Form : | Lyophilized powder |
AA Sequence : | MSVIFHENPGTSLGSVVPDTNTSFERESQLSVKTSPEWIDELFPNVSFIDSPTHQVIRGF CRDVFVYRLPGGFRVRYWDAVILVPNILFLLFLILKCGSVIRKLRTGNSPVLRAFTLLVY VSTLVNIIRCAYSMTLSMTDGLEQTVDQTLWIIIKFFYLTAEFCALTFGLLFGHLDNGKS ILIALLGTLLVSIPHTAVQVIIEMKIIDNSWLPLTYFDIQSDGGFLFWVFSSAVLALVYF FIMCLPLVCCQKYTKLPSKGSFLIYCMMMVVLNVLQSMGAALILFKSSDGLCFVGVSTYV YFVLYPPIIYFTFLRKKLKTPPNNTSGLFMYRKHKDEQGSGDLPDSYYPRFSGLTSPSYD DLFDYDRDARFTHYDISRNEYVQNPHYNTYSTPLIMTSVETAESTVTTRTGSDDYAHHRD SMLSEPSTGTTTRHLKGLGPQGSLVFEDDPSSLTSLRM |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | tpra-1 |
Synonyms | tpra-1; D1046.5; Transmembrane protein adipocyte-associated 1 homolog |
UniProt ID | Q18936 |
◆ Recombinant Proteins | ||
CRYAB-3827H | Recombinant Human CRYAB Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PNLIPRP2-2413H | Recombinant Human PNLIPRP2 Protein, MYC/DDK-tagged | +Inquiry |
CAPN13-1120R | Recombinant Rat CAPN13 Protein | +Inquiry |
TNFRSF18-4602H | Active Recombinant Human TNFRSF18 protein, hFc-tagged | +Inquiry |
NEPRO-0016H | Recombinant Human NEPRO Protein, GST-Tagged | +Inquiry |
◆ Native Proteins | ||
LDH3-222H | Active Native Human Lactate Dehydrogenase 3 | +Inquiry |
Luciferase-10V | Native Vibrio fischeri Luciferase | +Inquiry |
20S Immunoproteasome-224C | Active Native Cynomolgus monkey 20S Immunoproteasome protein | +Inquiry |
LYZ-29007TH | Active Native Human LYZ | +Inquiry |
F2-90B | Active Native Bovine Thrombin | +Inquiry |
◆ Cell & Tissue Lysates | ||
LRG1-791HCL | Recombinant Human LRG1 cell lysate | +Inquiry |
SkeletalMuscles-543E | Equine Skeletal Muscles Lysate, Total Protein | +Inquiry |
QSOX1-2635HCL | Recombinant Human QSOX1 293 Cell Lysate | +Inquiry |
CDKL3-329HCL | Recombinant Human CDKL3 cell lysate | +Inquiry |
CUL4B-7181HCL | Recombinant Human CUL4B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All tpra-1 Products
Required fields are marked with *
My Review for All tpra-1 Products
Required fields are marked with *
0
Inquiry Basket